Search

Search Funnelback University

Search powered by Funnelback
10 results 20 results 50 results
Relevance Date (Newest first) Date (Oldest first) Title (A-Z) Title (Z-A) Distance URL (A-Z) URL (Z-A) Shuffle
31 - 40 of 158 search results for TALK:PC53 20 where 0 match all words and 158 match some words.

  1. Results that match 1 of 2 words

  2. astrolabe.dvi

    https://www.joh.cam.ac.uk/sites/default/files/documents/build_your_own_astrolabe.pdf
    13 Jan 2011: 20. 20. 30. 30. 40. 10. 50. 20. 60. 30. 70. ... a) Rule (b) Alidade. 20. 20. 10. 10. 0. 0. 10.

  3. A Conserved Archaeal Pathway for TailAnchored Membrane Protein…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf
    11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20

  4. JCB: Article The Rockefeller University Press $30.00J. Cell Biol. ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/J%20Cell%20Biol%202010%20Howes.pdf
    24 Aug 2011: B) 20–25 cells treated as in A were used to calculate the volume fraction (V(v)). ... Bar, 200 nm. (G) Stereology measurements were captured across 20–25 cells in three independent areas as treated in F.

  5. wordmark_print_b_tranparentBG

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/EMBO_Endocytosis.pdf
    26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20.
    By: mackensen

  6. as at 8 November 2011 ANNUAL REPORT AND ACCOUNTS ...

    https://www.wolfson.cam.ac.uk/sites/default/files/2018-08/rccawolfson1011.pdf
    10 Nov 2011: Furniture and fittings 10% per annum General equipment 20% per annum Computer equipment 25% per annum. ... 20 << Contents >>. INCOME AND EXPENDITURE ACCOUNT. For the year ended 30 June 2011 2010 Restated.

  7. Molecular Biology of the CellVol. 21, 4325– 4337, December ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/67_Emerman_AE_MBC_2010.pdf
    11 Nov 2011: C D. 0. 20. 40. 60. 80. 100. SA-PrPBio. Prl-PrP(G123P)BioPrPBio. PrP(AV3)Bio. ... rPHA. PrPBi. o. PrP2H. A. PrPBi. o. PrP2H. A. cyt-BirA:ER-BirA: - -. - -- -. - -. BirA:[Biotin]:. - - 0 2 5 10 20 50 20 50.

  8. Molecular mechanism and physiological functions of clathrin-mediated…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf
    19 Jul 2011: These cargo-specific adaptor proteins always bind the core adaptor AP2 (REFS 20,21) (FIG.
    By: Harvey T. McMahon, Emmanuel Boucrot

  9. Nouvelles.indd

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Boucrot%20Med%20Sci%20(Paris)%202011.pdf
    7 Mar 2011: Mol Biol Cell 2009 ; 20 : 3251-60. 19. Ehrlich M, Boll W, Van Oijen A, et al. ... Mol Biol Cell 2009 ; 20 : 4640-51. 31. Frost A, Unger VM, De Camilli P.
    By: Administrateur

  10. Volume 22 May 15, 2011 1625 Cytosolic aggregates perturb ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/69_Chakrabarti_O_MBC_2011.pdf
    11 Nov 2011: In cells containing mCFP-PrP40–231 aggregates, we observed increased in-tracellular accumulation of CRFR1 in 20% of cells (Table 1; exam-ples in Figure 7). ... 6.0% (8/133). n.d. n.d. 20% (25/128). 6.5% (10/155). None n.d. 3.8% (5/129).

  11. 1;1 TheOpen University EMPIRE STATE COLLEGE STATE UNIVERSITY OF ...

    https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1991-cde.pdf
    7 Dec 2011: 20 Access and equal opportunities: strategies to realize our pious aspirations (a Canadian Perspective) by Ross H. ... Almost 73% of the students reported to work more than 10 hnitre week, 6% worked 20 hours or more The majority answered that they put in

Refine your results

clear all

Format

clear all

Date

Related searches for TALK:PC53 20

By site

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.