Search
Search Funnelback University
- Refined by:
- Date: 2011
- Format: pdf
1 -
50 of
158
search results for TALK:PC53 20
where 0
match all words and 158
match some words.
Results that match 1 of 2 words
-
Research Horizons Issue 14
https://www.cam.ac.uk/system/files/issue_14_research_horizons.pdf17 Mar 2011: Features 18–29Defending crops with maths 18. Trust on the wild web 20. -
THE 11 th CAMBRIDGE CONFERENCE Cambridge, United Kingdom 20 ...
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2005-2-cde.pdf7 Dec 2011: THE 11 th CAMBRIDGE CONFERENCE Cambridge, United Kingdom. 20 September 2005. ... For example, 20% of all tertiary-level students in India today are studying at a distance and the government wants to raise that to 40%. -
Cambridge University Reporter, Friday 20 May 2011
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/weekly/6225/6225.pdf8 Jun 2011: C O N T E N T S. 810 CAMBRIDGE UNIVERSITY REPORTER 20 May 2011. ... 812 CAMBRIDGE UNIVERSITY REPORTER 20 May 2011. The Cambridge University Reporter appears on Wednesdays during Term. -
526� CAMBRIDGE�UNIVERSITY�REPORTER� 23�February�2011 N O T i C E ...
https://www.cam.ac.uk/sites/www.cam.ac.uk/files/about-the-university/fees.pdf22 Feb 2011: 20. Severalspeakersexpressedconcernaboutthefutureof thearts,humanities,andsocialsciencesfollowingtheGovernment’s decisions on reducing Teaching Grant and introducing higher fees. ... access9 -
molcel3956mmc1
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Salje2011Supp.pdf20 Jul 2011: Cells were lysed in buffer A (20 mM Tris pH 8.5, 500 mM NaCl, 0.1 mM EDTA), supplemented with DNase (Sigma) and protease inhibitor tablets (Roche) by passing it ... J Biochem Biophys Methods 67, 67-74. << /ASCII85EncodePages false /AllowTransparency -
FINAL E&D Data Report 2010
https://www.equality.admin.cam.ac.uk/files/data_200910.pdf5 Sep 2011: Proportions (%) within All University Staff of known Nationality. 0% 5% 10% 15% 20% 25% 30% 35% 40% 45% 50% 55% 60% 65%. ... Proportions (%) within All University Staff of known Nationality. 0% 5% 10% 15% 20% 25%. -
astrolabe.dvi
https://www.joh.cam.ac.uk/sites/default/files/2017-10/Astrolabe%20kit.pdf13 Jan 2011: 20. 20. 30. 30. 40. 10. 50. 20. 60. 30. 70. ... a) Rule (b) Alidade. 20. 20. 10. 10. 0. 0. 10. -
c h r i s t ’s c o ...
https://alumni.christs.cam.ac.uk/file/2011-Magazine.pdf18 Oct 2011: This compares with more than 20% at the Cambridge College with the highest participation rate and we hope alumni will help us to do as well in the future. -
CAMBRIDGE COLLEGES FEDERATED PENSION SCHEME
https://www.pensions.admin.cam.ac.uk/files/2010.pdf8 Aug 2011: 9. Fund. Performance. Portfolio. Activity. The Fund returned 20.6% over the year to 31 March 2010. -
Research Horizons Issue 15
https://www.cam.ac.uk/system/files/issue_15_research_horizons.pdf4 Jul 2011: Knowledge exchange 18–19Exploding the ivory tower myth. Preview 20–21Eruptions that shook the world. ... Nevertheless, noneof the projects is a trivial undertaking, as Dr Hibberd explained: “We’re looking aheadto at least 15–20 years from now, -
The 11th Cambridge International Conference on Open and Distance ...
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2005-4-cde.pdf7 Dec 2011: Assessment and Evaluation in Higher Education, 20(3), 251-259. Canton, P. and Carusetta, E. ... Assessment and Evaluation in Higher Education, 20(1), 25-36. Jeff, P. and Smart, R. -
Council Notice on Access Agreement final
https://www.cam.ac.uk/sites/www.cam.ac.uk/files/about-the-university/access-agreement.pdf16 Mar 2011: c. The Colleges and the University have raised over £2.5m towards the CBS since 2006 (about 20% of the total spent between 2006/07 and 2009/10). -
373_431_BIOsp_0411
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Biospektrum2011%20Gasper.pdf1 Jul 2011: 2B). BtubA/B bilden in vitro dimere Filamente,die sich zu einem Komplex aus 20 bis 30 Fila-menten bündeln können. -
EQUALITY &DIVERSITY ANNUALREVIEW 2009 - 2010 Forewords 2009-2010…
https://www.equality.admin.cam.ac.uk/files/review_200910.pdf13 May 2011: 20 — 21. 11. The findings of the 2009Equal Pay report are available from:http://www.drc.admin.cam.ac.uk/reporter/2009-10/weekly/6185/section1.shtml#heading2-6. ... Undisclosed 20.4% 6.0%. Data Figure 7Disabled Students 2007/08 and 2008/09. 3.1.6 Other -
Cambridge University Reporter, Wednesday, 20 July 2011
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/weekly/6232/6232.pdf11 Nov 2011: theIsaacNewtonInstituteforMathematicalSciences; (v) abequestof £542,594fromtheestateof MrsA.C.M.Arnoldtosupportworkinretinalresearchinthe. Departmentof Pathology. University Tribunal: NoticeThe University Tribunal met on 20 May 2011 to consider a -
Research Horizons
https://www.cam.ac.uk/system/files/issue_16_research_horizons.pdf24 Oct 2011: Powerful words 18. Mother tongue, prehistoric 19father. Preview 20–21Past versus present in an age ofprogress: the Victorians. -
AFRICAN VIRTUAL UNIVERSI TY UNIVERSITE VIRTUELLE AFRICAINE UN…
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2005-3-cde.pdf7 Dec 2011: Madingley Hall Cambridge UK 20-23 September 2005. THE AFRICAN RESEARCHER, THE AVU EXPERIENCES. -
Abstract_Book_HMM_v2
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/JM_Abstract_Book.pdf15 Sep 2011: Daumke. 16:00 --. 19:30. Registration. 16:00 Coffee break. 16:20 Coffee break. ... du réseau neuronal 10:20-10:50 Coffee break - Pause café. Session II. -
allies workplace guide_2 colour text_Stonewall guide
https://www.equality.admin.cam.ac.uk/files/straight_allies.pdf10 May 2011: allies workplace guide_2 colour text_Stonewall guide 10/05/2011 16:17 Page 20. Many straight allies running organisations feel that their leadership. ... early stages of my career, 15 to 20 years ago at another bank,. -
1 University of Cambridge The Government White Paper: Students ...
https://www.cam.ac.uk/sites/www.cam.ac.uk/files/about-the-university/council-white-paper-response.pdf29 Sep 2011: 17. VAT Cost-Sharing (1.20) – we welcome the consultation on the possibility of removing the VAT charge which currently hampers cost-sharing between institutions. ... 20. The Government rightly questions the variability of student workloads. across the -
THE OPEN UNIVERSITY International Council for Distance Education OPEN …
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1983-CDE.pdf7 Dec 2011: on. CounselTina in Distance Education. 20-22 September 1983 Downing College, Cambridge, United Kingdom. ... University study'. Teaching at a distance No. 20, OU, 1981). (b) Students manipulating tutors into a formal role in tutorials. -
Date: 4-5th April 2011 Venue: School of Biosciences, University ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/BirminghamProgram.pdf4 Mar 2011: Recommended Hotels: Menzies Strathallan 225 Hagley Road Birmingham, West Midlands B16 9RY 0121 455 9777 Price range: £50-60 per night Premier Inn Birmingham Broad St (Canal Side) 20 Bridge Street -
anti bullying _Stonewall guide
https://www.equality.admin.cam.ac.uk/files/bullying_workplace.pdf11 Oct 2011: within their team. anti bullying _Stonewall guide 11/10/2011 17:34 Page 20. ... 20. CONSULTATION In order to develop and maintain an effective system which prevents anti-. -
Molecular basis for membraneremodelling and organization Deadline for …
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/F-BAR_proteins/Le%20Poster_DEUXNew.pdf29 Sep 2011: Molecular basis for membraneremodelling and organization. Deadline for application is 20 May 2011. -
Biochem. J. (2011) 440, 185–193 (Printed in Great Britain) ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/ChernomordikBJ2011.pdf15 Nov 2011: andMiTMAB. The reagents were applied either before (for 30 min)or immediately after low pH application (for 20 min). ... Virology 404, 117–126. 20 Dawson, J. C., Legg, J. A. and Machesky, L. -
Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf23 Sep 2011: Folch liposomes (400 nm).Endophilin N-BAR domain was used at 1, 2, 5, 10, and 20 M. ... A, Averaged capacitance responses to 20 ms depo-larization after dialysis of D. -
wordmark_print_b_tranparentBG
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/EMBO_Endocytosis.pdf26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20. -
CAMBRIDGE COLLEGES FEDERATED PENSION SCHEME
https://www.pensions.admin.cam.ac.uk/files/2011.pdf8 Aug 2011: statements on pages 14 to 22 of this report. For the period 1 April 2010 to 31 March 2011 total contribution rates to the Scheme ranged from 20.87% to. -
ECONOMICS TRIPOS PART I Friday 17 June 2011 9.00 ...
https://www.robinson.cam.ac.uk/iar1/teaching/p1paper3_2011.pdf10 Jun 2011: STATIONERY REQUIREMENTS SPECIAL REQUIREMENTS. 20 Page booklet x 2 List of statistical formulae. ... Number of 5 8 5 20 20 6 7 9? 10familiesreceivingannualincome X. -
D O W N I N G C O ...
https://www.dow.cam.ac.uk/sites/default/files/accounts10.pdf5 Jan 2011: Economics 6 6 7 0 19 20. Engineering 11 12 9 9 41 43. ... 20. Year Ended 30 June 2010 | Report of the Governing Body C O L L E G E G OV E R NA N C E. -
astrolabe.dvi
https://www.joh.cam.ac.uk/sites/default/files/documents/build_your_own_astrolabe.pdf13 Jan 2011: 20. 20. 30. 30. 40. 10. 50. 20. 60. 30. 70. ... a) Rule (b) Alidade. 20. 20. 10. 10. 0. 0. 10. -
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20 -
JCB: Article The Rockefeller University Press $30.00J. Cell Biol. ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/J%20Cell%20Biol%202010%20Howes.pdf24 Aug 2011: B) 20–25 cells treated as in A were used to calculate the volume fraction (V(v)). ... Bar, 200 nm. (G) Stereology measurements were captured across 20–25 cells in three independent areas as treated in F. -
as at 8 November 2011 ANNUAL REPORT AND ACCOUNTS ...
https://www.wolfson.cam.ac.uk/sites/default/files/2018-08/rccawolfson1011.pdf10 Nov 2011: Furniture and fittings 10% per annum General equipment 20% per annum Computer equipment 25% per annum. ... 20 << Contents >>. INCOME AND EXPENDITURE ACCOUNT. For the year ended 30 June 2011 2010 Restated. -
Protein-driven membrane stresses in fusion and fission
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/KozlovCurvature2010.pdf21 Feb 2011: Nat. Rev. Mol. Cell Biol. 7, 9–19. 20 Kozlov, M.M. and Chernomordik, L.V. ... Biochim. Biophys. Acta 1793, 20–26. 70 Peters, C. et al. (2004) Mutual control of membrane fission and fusionproteins. -
Molecular Biology of the CellVol. 21, 4325– 4337, December ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/67_Emerman_AE_MBC_2010.pdf11 Nov 2011: C D. 0. 20. 40. 60. 80. 100. SA-PrPBio. Prl-PrP(G123P)BioPrPBio. PrP(AV3)Bio. ... rPHA. PrPBi. o. PrP2H. A. PrPBi. o. PrP2H. A. cyt-BirA:ER-BirA: - -. - -- -. - -. BirA:[Biotin]:. - - 0 2 5 10 20 50 20 50. -
Molecular mechanism and physiological functions of clathrin-mediated…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf19 Jul 2011: These cargo-specific adaptor proteins always bind the core adaptor AP2 (REFS 20,21) (FIG. -
Nouvelles.indd
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Boucrot%20Med%20Sci%20(Paris)%202011.pdf7 Mar 2011: Mol Biol Cell 2009 ; 20 : 3251-60. 19. Ehrlich M, Boll W, Van Oijen A, et al. ... Mol Biol Cell 2009 ; 20 : 4640-51. 31. Frost A, Unger VM, De Camilli P. -
Volume 22 May 15, 2011 1625 Cytosolic aggregates perturb ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/69_Chakrabarti_O_MBC_2011.pdf11 Nov 2011: In cells containing mCFP-PrP40–231 aggregates, we observed increased in-tracellular accumulation of CRFR1 in 20% of cells (Table 1; exam-ples in Figure 7). ... 6.0% (8/133). n.d. n.d. 20% (25/128). 6.5% (10/155). None n.d. 3.8% (5/129). -
1;1 TheOpen University EMPIRE STATE COLLEGE STATE UNIVERSITY OF ...
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1991-cde.pdf7 Dec 2011: 20 Access and equal opportunities: strategies to realize our pious aspirations (a Canadian Perspective) by Ross H. ... Almost 73% of the students reported to work more than 10 hnitre week, 6% worked 20 hours or more The majority answered that they put in -
The life of proteins: the good, the mostly good and the ugly
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/68_Morimoto_RI_NSMB_2011.pdf7 Jan 2011: Systematic biochemical studies also elucidated the mechanism by which Ero1-α oxidizes PDI specifically and efficiently among nearly 20 types of PDI-family member proteins. -
Membrane Protein Insertion at the Endoplasmic Reticulum
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/75_Shao_S_Ann_Rev_2011.pdf9 Nov 2011: For insertion into the ER, the “ideal”TMD is a 20 residue α-helix composed ofnonpolar, mostly hydrophobic side chains. ... 1996,Heinrich et al. 2000). With further synthesis ofat least 20 residues beyond the TMD, it wouldhave the potential freedom -
pii:B978-0-12-372568-4.00001-X
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/MartensCTMchapter6.pdf3 May 2011: CHAPTER 6. C2 Domains and Membrane Fusion. Sascha Martens1 and Harvey T. McMahon21 Max F. Perutz Laboratories, University of Vienna, Vienna, Austria2 MRC Laboratory of Molecular Biology, Cambridge, United Kingdom. I. OverviewII. Membrane Fusion. A. -
TheOpen University PUTTING THE STUDENT FIRST LEARNER-CENTRED…
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1995-cde.pdf7 Dec 2011: p 20. Sharifah Alwiah Alsagoff. 4 Is it appropriate to have students evaluate final examination of distance education students? ... Carla Payne. 20 Why_computer conferencing may help students more than face to face teaching. -
ECONOMICS TRIPOS PART IIA Thursday 9 June 2011 9-12 ...
https://www.robinson.cam.ac.uk/iar1/teaching/p2apaper6_2011.pdf18 Mar 2011: STATIONERY REQUIREMENTS SPECIAL REQUIREMENTS. 20 Page booklet x 2 Approved calculators allowed. -
Summer 2011wheel Catharine The light fantastic The history of ...
https://www.caths.cam.ac.uk/sites/default/files/The%20Wheel%202011.pdf5 May 2011: Between 20 March and 3 April, twelve of our current students had an opportunity to talk to you, hear your memories of St Catharine’s and witness your generosity in supporting ... 20 months, over 24,600 km, 20 countries and two continents later Helen -
245 CAMBRIDGE UNIVERSITY REPORTER 29 November 2011 NOTES TO ...
https://www.reporter.admin.cam.ac.uk/reporter/2011-12/weekly/6246/vii.pdf29 Nov 2011: 7 72.7 278.9 533.3 523.5Equipment 8.0 11.8 0.4 20.2 19.5. ... undertakings. Other undertakings where the University’s investment amounts to 20% or more are also listed below. -
22 CAMBRIDGE UNIVERSITY REPORTER 18 January 2011 Expenditure:…
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/09/sectiond.pdf17 Jan 2011: 277 8 8 – 16 – – – – – – 12 – – –English 3,101 126 12 3,239 2,949 2 10 – 12 15 182 58 – 240 347 18 20 280 476 French 1,278 24 – ... 314 – 652 571 – 5 – 5 19 43 18 – 61 109 5 20 96 144. -
Papers by authors A to E
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2011-authorsA-E.pdf8 Sep 2011: Posting by Sahar G. Youssef 090776 - Sunday, 24 April 2011, 09:20 PM. ... How. 20. inclusive pronouns, pronouns of solidarity and direct addressing are reflected in. -
123456789…
https://www.robinson.cam.ac.uk/postkeynesian/downloads/Lang/DL120213.pdf29 Jul 2011: The distinction is clear in terms of the Lucas (1972) account of market-clearing, price-taking equilibrium, as pointed out by LNJ (20 – 21), but Lucas did not coin the natural ... The time path of actual unemployment is set to minimise :. 12 2 20 ( )U
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.