Search
Search Funnelback University
- Refined by:
- Date: 2004
- Format: pdf
1 -
10 of
129
search results for TALK:PC53 20
where 0
match all words and 129
match some words.
Results that match 1 of 2 words
-
A-nsmb855.indd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nsmb%20FtsZ%202004.pdf19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture. -
mmi_4133.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Spo0J%202004.pdf30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/ford01.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/epsin/EM/ford.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
Finance 2004 - 72458.qk
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/08/a-e.pdf12 Jan 2004: 3 — 3 1 27 — — 27 28 39 39 76 110 — 186 116 127 134 — 261 141 330 174 — 20 — 20 11 161 139 — 300 409 356 468 — — — — — — — — — — — —— 22 — 22 13 149 ... 20 20 21Computer Laboratory 2,080 337 48 2,465 2,296 20 -
32 CAMBRIDGE UNIVERSITY REPORTER [SPECIAL NO. 9 M. S. ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/09/2.pdf22 Jan 2004: PWF Club locationsChemical Engineering 10 16 34 220Economics 4 7 22 85Law 2 5 95 20. ... 5 168 118Photoshop for Photographers: basic 1 19Photoshop: further techniques 5 1 92 20. -
75934 Student Number 2004
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/19/studentnumber2004.pdf23 Aug 2004: Criminology 8 14 22 — — —M.Phil. Development Studies 20 23 43 — — —M.Phil. ... Philosophy of ScienceHistory and Philosophy of Science 24 20 44 8 5 13. -
53091 361..366
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/McMahon01020.pdf3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al. -
Form PD26: Personal Development Plan
https://www.hr.admin.cam.ac.uk/files/pd26.pdf16 Dec 2004: Signature of Staff Member. Date. Signature of Reviewer. Date. << /ASCII85EncodePages false /AllowTransparency false /AutoPositionEPSFiles true /AutoRotatePages /All /Binding /Left /CalGrayProfile (Dot Gain 20%) /CalRGBProfile (sRGB IEC61966-2.1) -
mmi_3991.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ftsn2004.pdf15 Apr 2004: Amersham) in 20 mMNa-Phosphate, pH 6.0, 1 mM EDTA, 1 mM DTT. ... Residues 5–75 0.62 0.15 Å(All heavy atoms). Residues 5–75 1.20 0.17 Å.
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.