Search

Search Funnelback University

Search powered by Funnelback
31 - 40 of 63 search results for KaKaoTalk:vb20 200 where 0 match all words and 63 match some words.
  1. Results that match 1 of 2 words

  2. A Conserved Archaeal Pathway for TailAnchored Membrane Protein…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf
    11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing
  3. 22 CAMBRIDGE UNIVERSITY REPORTER 18 January 2011 Expenditure:…

    https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/09/sectiond.pdf
    17 Jan 2011: 572 3,058 – 5,630 6,826 13,984 11,654 1,185 26,823 28,705 5,780 6,657 36,200 38,954. ... 4,008 5,382 – – – – – – – – – – – – – –. TOTAL ACADEMIC SERVICES 22,725 11,800 238 34,763 33,753 1,844 1,322 – 3,166 4,200 570 80 –
  4. THE OPEN UNIVERSITY International Council for Distance Education OPEN …

    https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1983-CDE.pdf
    7 Dec 2011: THE OPEN UNIVERSITY International Council for. Distance Education. OPEN UNIVERSITY REGIONAL ACADEMIC SERVICES. in conjunction with. INTERNATIONAL COUNCIL FOR DISTANCE EDUCATION (ICDE). INTERNATIONAL WORKSHOP. on. CounselTina in Distance Education. 20
  5. Molecular Biology of the CellVol. 21, 3054 –3069, September ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/RVS161_MBC2010.pdf
    21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003).
  6. Section F: Funding body grants 2011 2010£000 £000 Recurrent ...

    https://www.reporter.admin.cam.ac.uk/reporter/2011-12/special/06/FMI-F.pdf
    21 Dec 2011: Total HEFCE grants included in income 200,833 202,546. 26.
  7. The Cambridge International Conference on Open and Distance Learning…

    https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1999-cde.pdf
    7 Dec 2011: The Cambridge International Conference on Open and Distance Learning. Learning and Teaching with New Technologies. Collected Conference Papers September 1999. Edited by Roger Mills and Alan Tait Editorial Assistant: Sue Sheppard. Open University
  8. C A M B R I D G E ...

    https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/14/undergrad_stats.pdf
    5 May 2011: No. % No. % Success rate (%)Northern Ireland 200 1 66 2 33North East 270 2 67 2 25Wales 290 2 65 2 22Scotland 370 2 86 3 23East Anglia 577 4 148 ... North West 850 5 200 6 24. London 2,290 14 631 19 28.
  9. Papers by authors F to L

    https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2011-authorsF-L.pdf
    8 Sep 2011: 1. Cambridge International Conference on Open, Distance and e-Learning. Internationalisation and Social Justice: the role of Open, Distance and e-Learning. Papers by authors F - L. Page. Ahmad Fadlallah Bridging the gap in digital divide 3. Maria de
  10. Molecular mechanism and physiological functions of clathrin-mediated…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf
    19 Jul 2011: 3a). The size of clathri n-coated vesicles depends on the size of its cargo76, with an observed upper limit of about 200 nm external diameter, as in the case of
  11. 18 January 2011 CAMBRIDGE UNIVERSITY REPORTER 75 Section L: ...

    https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/09/sectionl.pdf
    17 Jan 2011: Research Council 39,433 368 Economic & Social Research Council 5,421 73 Medical Research Council 26,537 200 Natural Environment Research Council 3,999 109 Royal Society 6,835 208 Science &

Refine your results

clear all

Format

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.