Search
Search Funnelback University
- Refined by:
- Date: 2011
- Format: pdf
31 -
40 of
63
search results for KaKaoTalk:vb20 200
where 0
match all words and 63
match some words.
Results that match 1 of 2 words
-
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing -
22 CAMBRIDGE UNIVERSITY REPORTER 18 January 2011 Expenditure:…
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/09/sectiond.pdf17 Jan 2011: 572 3,058 – 5,630 6,826 13,984 11,654 1,185 26,823 28,705 5,780 6,657 36,200 38,954. ... 4,008 5,382 – – – – – – – – – – – – – –. TOTAL ACADEMIC SERVICES 22,725 11,800 238 34,763 33,753 1,844 1,322 – 3,166 4,200 570 80 – -
THE OPEN UNIVERSITY International Council for Distance Education OPEN …
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1983-CDE.pdf7 Dec 2011: THE OPEN UNIVERSITY International Council for. Distance Education. OPEN UNIVERSITY REGIONAL ACADEMIC SERVICES. in conjunction with. INTERNATIONAL COUNCIL FOR DISTANCE EDUCATION (ICDE). INTERNATIONAL WORKSHOP. on. CounselTina in Distance Education. 20 -
Molecular Biology of the CellVol. 21, 3054 –3069, September ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/RVS161_MBC2010.pdf21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003). -
Section F: Funding body grants 2011 2010£000 £000 Recurrent ...
https://www.reporter.admin.cam.ac.uk/reporter/2011-12/special/06/FMI-F.pdf21 Dec 2011: Total HEFCE grants included in income 200,833 202,546. 26. -
The Cambridge International Conference on Open and Distance Learning…
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1999-cde.pdf7 Dec 2011: The Cambridge International Conference on Open and Distance Learning. Learning and Teaching with New Technologies. Collected Conference Papers September 1999. Edited by Roger Mills and Alan Tait Editorial Assistant: Sue Sheppard. Open University -
C A M B R I D G E ...
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/14/undergrad_stats.pdf5 May 2011: No. % No. % Success rate (%)Northern Ireland 200 1 66 2 33North East 270 2 67 2 25Wales 290 2 65 2 22Scotland 370 2 86 3 23East Anglia 577 4 148 ... North West 850 5 200 6 24. London 2,290 14 631 19 28. -
Papers by authors F to L
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2011-authorsF-L.pdf8 Sep 2011: 1. Cambridge International Conference on Open, Distance and e-Learning. Internationalisation and Social Justice: the role of Open, Distance and e-Learning. Papers by authors F - L. Page. Ahmad Fadlallah Bridging the gap in digital divide 3. Maria de -
Molecular mechanism and physiological functions of clathrin-mediated…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf19 Jul 2011: 3a). The size of clathri n-coated vesicles depends on the size of its cargo76, with an observed upper limit of about 200 nm external diameter, as in the case of -
18 January 2011 CAMBRIDGE UNIVERSITY REPORTER 75 Section L: ...
https://www.reporter.admin.cam.ac.uk/reporter/2010-11/special/09/sectionl.pdf17 Jan 2011: Research Council 39,433 368 Economic & Social Research Council 5,421 73 Medical Research Council 26,537 200 Natural Environment Research Council 3,999 109 Royal Society 6,835 208 Science &
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.