Search
Search Funnelback University
- Refined by:
- Date: 2004
- Format: pdf
1 -
10 of
128
search results for TALK:PC53 20
where 0
match all words and 128
match some words.
Results that match 1 of 2 words
-
A-nsmb855.indd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nsmb%20FtsZ%202004.pdf19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture. -
mmi_4133.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Spo0J%202004.pdf30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/ford01.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/epsin/EM/ford.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
53091 361..366
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/McMahon01020.pdf3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al. -
Finance 2004 - 72458.qk
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/08/a-e.pdf12 Jan 2004: 3 — 3 1 27 — — 27 28 39 39 76 110 — 186 116 127 134 — 261 141 330 174 — 20 — 20 11 161 139 — 300 409 356 468 — — — — — — — — — — — —— 22 — 22 13 149 ... 20 20 21Computer Laboratory 2,080 337 48 2,465 2,296 20 -
mmi_3991.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ftsn2004.pdf15 Apr 2004: Amersham) in 20 mMNa-Phosphate, pH 6.0, 1 mM EDTA, 1 mM DTT. ... Residues 5–75 0.62 0.15 Å(All heavy atoms). Residues 5–75 1.20 0.17 Å. -
Evolving nature of the AP2 a-appendage hubduring clathrin-coated…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/AP2Hub_EMBO2004/AP2Praefcke2004.pdf23 Nov 2004: There are well over 20 proteins implicated in clathrin-. coated vesicle (CCV) assembly. ... 20. 15. 10. 5. 0. 5. Eps15-MD. Epsin1-MD+. Appendage to protein ratio. -
32 CAMBRIDGE UNIVERSITY REPORTER [SPECIAL NO. 9 M. S. ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/09/2.pdf22 Jan 2004: PWF Club locationsChemical Engineering 10 16 34 220Economics 4 7 22 85Law 2 5 95 20. ... 5 168 118Photoshop for Photographers: basic 1 19Photoshop: further techniques 5 1 92 20. -
75934 Student Number 2004
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/19/studentnumber2004.pdf23 Aug 2004: Criminology 8 14 22 — — —M.Phil. Development Studies 20 23 43 — — —M.Phil. ... Philosophy of ScienceHistory and Philosophy of Science 24 20 44 8 5 13.
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
- economics at caius |u:www.polis.cam.ac.uk (24) · moments ago
- `James Watson` |u:www.mrl.ims.cam.ac.uk (2) · moments ago
- `Towers Watson` |u:www.cisl.cam.ac.uk (0) · moments ago
Recent searches
Your search history is empty.