Search
Search Funnelback University
- Refined by:
- Date: 2011
- Format: pdf
21 -
40 of
158
search results for TALK:PC53 20
where 0
match all words and 158
match some words.
Results that match 1 of 2 words
-
allies workplace guide_2 colour text_Stonewall guide
https://www.equality.admin.cam.ac.uk/files/straight_allies.pdf10 May 2011: allies workplace guide_2 colour text_Stonewall guide 10/05/2011 16:17 Page 20. Many straight allies running organisations feel that their leadership. ... early stages of my career, 15 to 20 years ago at another bank,. -
1 University of Cambridge The Government White Paper: Students ...
https://www.cam.ac.uk/sites/www.cam.ac.uk/files/about-the-university/council-white-paper-response.pdf29 Sep 2011: 17. VAT Cost-Sharing (1.20) – we welcome the consultation on the possibility of removing the VAT charge which currently hampers cost-sharing between institutions. ... 20. The Government rightly questions the variability of student workloads. across the -
THE OPEN UNIVERSITY International Council for Distance Education OPEN …
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1983-CDE.pdf7 Dec 2011: on. CounselTina in Distance Education. 20-22 September 1983 Downing College, Cambridge, United Kingdom. ... University study'. Teaching at a distance No. 20, OU, 1981). (b) Students manipulating tutors into a formal role in tutorials. -
Date: 4-5th April 2011 Venue: School of Biosciences, University ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/BirminghamProgram.pdf4 Mar 2011: Recommended Hotels: Menzies Strathallan 225 Hagley Road Birmingham, West Midlands B16 9RY 0121 455 9777 Price range: £50-60 per night Premier Inn Birmingham Broad St (Canal Side) 20 Bridge Street -
anti bullying _Stonewall guide
https://www.equality.admin.cam.ac.uk/files/bullying_workplace.pdf11 Oct 2011: within their team. anti bullying _Stonewall guide 11/10/2011 17:34 Page 20. ... 20. CONSULTATION In order to develop and maintain an effective system which prevents anti-. -
Biochem. J. (2011) 440, 185–193 (Printed in Great Britain) ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/ChernomordikBJ2011.pdf15 Nov 2011: andMiTMAB. The reagents were applied either before (for 30 min)or immediately after low pH application (for 20 min). ... Virology 404, 117–126. 20 Dawson, J. C., Legg, J. A. and Machesky, L. -
Molecular basis for membraneremodelling and organization Deadline for …
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/F-BAR_proteins/Le%20Poster_DEUXNew.pdf29 Sep 2011: Molecular basis for membraneremodelling and organization. Deadline for application is 20 May 2011. -
Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf23 Sep 2011: Folch liposomes (400 nm).Endophilin N-BAR domain was used at 1, 2, 5, 10, and 20 M. ... A, Averaged capacitance responses to 20 ms depo-larization after dialysis of D. -
Protein-driven membrane stresses in fusion and fission
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/KozlovCurvature2010.pdf21 Feb 2011: Nat. Rev. Mol. Cell Biol. 7, 9–19. 20 Kozlov, M.M. and Chernomordik, L.V. ... Biochim. Biophys. Acta 1793, 20–26. 70 Peters, C. et al. (2004) Mutual control of membrane fission and fusionproteins. -
CAMBRIDGE COLLEGES FEDERATED PENSION SCHEME
https://www.pensions.admin.cam.ac.uk/files/2011.pdf8 Aug 2011: statements on pages 14 to 22 of this report. For the period 1 April 2010 to 31 March 2011 total contribution rates to the Scheme ranged from 20.87% to. -
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20 -
astrolabe.dvi
https://www.joh.cam.ac.uk/sites/default/files/documents/build_your_own_astrolabe.pdf13 Jan 2011: 20. 20. 30. 30. 40. 10. 50. 20. 60. 30. 70. ... a) Rule (b) Alidade. 20. 20. 10. 10. 0. 0. 10. -
JCB: Article The Rockefeller University Press $30.00J. Cell Biol. ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/J%20Cell%20Biol%202010%20Howes.pdf24 Aug 2011: B) 20–25 cells treated as in A were used to calculate the volume fraction (V(v)). ... Bar, 200 nm. (G) Stereology measurements were captured across 20–25 cells in three independent areas as treated in F. -
wordmark_print_b_tranparentBG
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/EMBO_Endocytosis.pdf26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20. -
as at 8 November 2011 ANNUAL REPORT AND ACCOUNTS ...
https://www.wolfson.cam.ac.uk/sites/default/files/2018-08/rccawolfson1011.pdf10 Nov 2011: Furniture and fittings 10% per annum General equipment 20% per annum Computer equipment 25% per annum. ... 20 << Contents >>. INCOME AND EXPENDITURE ACCOUNT. For the year ended 30 June 2011 2010 Restated. -
Molecular Biology of the CellVol. 21, 4325– 4337, December ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/67_Emerman_AE_MBC_2010.pdf11 Nov 2011: C D. 0. 20. 40. 60. 80. 100. SA-PrPBio. Prl-PrP(G123P)BioPrPBio. PrP(AV3)Bio. ... rPHA. PrPBi. o. PrP2H. A. PrPBi. o. PrP2H. A. cyt-BirA:ER-BirA: - -. - -- -. - -. BirA:[Biotin]:. - - 0 2 5 10 20 50 20 50. -
Molecular mechanism and physiological functions of clathrin-mediated…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf19 Jul 2011: These cargo-specific adaptor proteins always bind the core adaptor AP2 (REFS 20,21) (FIG. -
Nouvelles.indd
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Boucrot%20Med%20Sci%20(Paris)%202011.pdf7 Mar 2011: Mol Biol Cell 2009 ; 20 : 3251-60. 19. Ehrlich M, Boll W, Van Oijen A, et al. ... Mol Biol Cell 2009 ; 20 : 4640-51. 31. Frost A, Unger VM, De Camilli P. -
Volume 22 May 15, 2011 1625 Cytosolic aggregates perturb ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/69_Chakrabarti_O_MBC_2011.pdf11 Nov 2011: In cells containing mCFP-PrP40–231 aggregates, we observed increased in-tracellular accumulation of CRFR1 in 20% of cells (Table 1; exam-ples in Figure 7). ... 6.0% (8/133). n.d. n.d. 20% (25/128). 6.5% (10/155). None n.d. 3.8% (5/129). -
1;1 TheOpen University EMPIRE STATE COLLEGE STATE UNIVERSITY OF ...
https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/1991-cde.pdf7 Dec 2011: 20 Access and equal opportunities: strategies to realize our pious aspirations (a Canadian Perspective) by Ross H. ... Almost 73% of the students reported to work more than 10 hnitre week, 6% worked 20 hours or more The majority answered that they put in
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.