Search

19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture.

30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.

12 Jan 2004: 3 — 3 1 27 — — 27 28 39 39 76 110 — 186 116 127 134 — 261 141 330 174 — 20 — 20 11 161 139 — 300 409 356 468 — — — — — — — — — — — —— 22 — 22 13 149 ... 20 20 21Computer Laboratory 2,080 337 48 2,465 2,296 20

15 Apr 2004: Amersham) in 20 mMNa-Phosphate, pH 6.0, 1 mM EDTA, 1 mM DTT. ... Residues 5–75 0.62 0.15 Å(All heavy atoms). Residues 5–75 1.20 0.17 Å.

23 Nov 2004: There are well over 20 proteins implicated in clathrin-. coated vesicle (CCV) assembly. ... 20. 15. 10. 5. 0. 5. Eps15-MD. Epsin1-MD+. Appendage to protein ratio.

24 Sep 2004: substrate and product complexes.Cells were resuspended in buffer A (20 mM Tris pH 7.5 [4C], and100 mM NaCl) and disrupted with a French press. ... B.G.P. was supported by a fellowship from Secretarı́a de EstadoD [20 mM Tris (pH 7.5) (4C), 0.05 M

22 Jan 2004: PWF Club locationsChemical Engineering 10 16 34 220Economics 4 7 22 85Law 2 5 95 20. ... 5 168 118Photoshop for Photographers: basic 1 19Photoshop: further techniques 5 1 92 20.

2 Feb 2004: Dense body. Synapticvesicles10–20 min at 19C. Temperature shift. 2004 Nature Publishing Group.

23 Aug 2004: Criminology 8 14 22 — — —M.Phil. Development Studies 20 23 43 — — —M.Phil. ... Philosophy of ScienceHistory and Philosophy of Science 24 20 44 8 5 13.

23 Nov 2004: www.sciencedirect.com Current Opinion in Cell Biology 2004, 16:379–391. G-proteins are required for membrane recruitment[18,20,30,31]. ... L. J Cell Biol 1964, 20:313-332. 2. Pearse BM: Coated vesicles from pig brain: purification andbiochemical

24 Sep 2004: Native protein was expressed in C41(DE3) cells. Cells were resuspended in buffer A (20 mM Tris, pH 8.0, 50 mMpotassium phosphate, pH 8.0, and 100 mM NaCl) and ... Fractions con-. taining Vps23 UEV were pooled and diluted with an equal volume ofbuffer C

16 Dec 2004: Signature of Staff Member. Date. Signature of Reviewer. Date. << /ASCII85EncodePages false /AllowTransparency false /AutoPositionEPSFiles true /AutoRotatePages /All /Binding /Left /CalGrayProfile (Dot Gain 20%) /CalRGBProfile (sRGB IEC61966-2.1)

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

29 Dec 2004: the saturable component of bumetanide binding, Keq = k-l/k1 = 20 nM, was determined. ... 1 m. 0 IO 20 30 40. Time (min). 0 10 20 30 40 50 60 70 80.

30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m.

10 Mar 2004: 2003 Applications Acceptances and success rate Total % Men % Women % Total % Men % Women %. Black Caribbean 34 0.3 14 0.2 20 0.4 3 9 3 21 0 0Black African 112 ... 12 24 5 20 7 28Chinese 245 2 133 2 112 2 71 29 36 27 35 31Asian Other 172 2 84 2 88 2 40 23

17 Mar 2004: The negative surface potential, which isabout –30 mV for a membrane with 20% phos-phatidylserine [8], also attracts clusters of basicresidues on proteins. ... Dill, K.A., and Bromberg, S. (2003). Molecular Driving Forces.(Garland Science), Chapters

23 Nov 2004: 18–. 20, 29–31]. We examined the dynamics of this compart-main [27, 28]. ... Fig-Consistent with previous data [20, 30], SNX1 existedure 5B, data not shown).

5 Aug 2004: Figure 1: Applications for Graduate and Postgraduate Courses 1993–2003. 20 CAMBRIDGE UNIVERSITY REPORTER [SPECIAL NO. ... St Edmund’s College 2 2 2 1 16 4 20 7 6 3 3 1 16 12 25 16.

10 Mar 2004: 2003 Applications Acceptances and success rate Total % Men % Women % Total % Men % Women %. Black Caribbean 34 0.3 14 0.2 20 0.4 3 9 3 21 0 0Black African 112 ... 12 24 5 20 7 28Chinese 245 2 133 2 112 2 71 29 36 27 35 31Asian Other 172 2 84 2 88 2 40 23

10 Mar 2004: 947 19 12 31180–239 9,901 10,508 20,409 844 754 1,598 1 4 5120–179 2,713 2,524 5,237 27 30 57 0 0 0. ... 20, Level 2 = 10Free standing Mathematics units: A = 20, B = 17, C = 13, D = 10, E = 7.

23 Nov 2004: These reactionswere performed in KIN buffer {50 mM Mops ( pH 7.2),100 mM NaCl, 20 mM MgCl2, 0.5 mM ATP, and 2 mCiof [g-32P]ATP}. ... we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals

15 Mar 2004: a) From previous years’ sales data, 20% of customers whose air tickets cost between £500 and £2,000 flew business class. ... e 7.20 am 40 10.00 am f 7.35 am 25 2.00 pm.

15 Mar 2004: Explain your answer. [17]. Job Demand Current Stock A 10 260 B 15 195 C 40 880 D 2 20 E 5 75 F 80 1280. ... Millenium Lighting estimates a cost of £100 for placing an order, exclusive of purchase cost, and estimates a 20% annual cost of holding inventory

3 Jun 2004: 19. Ancient Egypt, 2The practice of religion. Paper E. 20. Ancient Egypt, 3Interconnections. ... L. Alsdorf), pp. 100–13.Sattasa$ ı (ed. A. Weber) stanzas 1–20, 375–95.

13 Dec 2004: 20,000. Deductible Items in accordance with Statute G, II,4: £11,624,858 at 15%. ... 25,000Health and Safety Regulations. 14,734Kitchens:. Contributions re Junior Members. 20,902Corkage Subsidy.

13 Dec 2004: 20,000. Deductible Items in accordance with Statute G, II,4: £11,624,858 at 15%. ... 25,000Health and Safety Regulations. 14,734Kitchens:. Contributions re Junior Members. 20,902Corkage Subsidy.

3 Jun 2004: 15, 18, 36.International Law (i): Papers 15, 19, 20, 21, 23, 36. ... R. Lanman, A Sanskrit Reader, pp. 20–44).Kath $asarits $agara, extracts 22–27 (Lanman, pp.

22 Sep 2004: JONES (Cu). Experimental Approaches: Cells and Molecules. (14, 15,20 Oct.). DR R. ... Twelve lectures, beginning 20 Jan.). Human Genetics, Genomics and Systems BiologyThe same continued.

30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m.

4 May 2004: Only data extending to about 20/ resolution (within the first zero in the contrast transfer function) were used. ... Biochemistry 20, 2181-2191. Conti-Tronconi, B. M., McLane, K. E., Raftery, M.

1 May 2004: The best-characterizedsystem in this context is Spo0J fromB. subtilisand 8–10 copies ofcis-actingparSelements situated around 20% of theoriC region (86). ... 20. Cordell SC, L owe J. 2001. Crystal struc-ture of the bacterial cell division regulatorMinD.

21 Jul 2004: 923 £949 2%22 23 £37,187 £37,975 £788 2%21 22 £35,370 £37,187 £1,816 5%20A 21 £34,838 £35,370 £533 2%20 21 ... 202 £35,370 £1,168 3%20 20A £34,202 £34,838 £635 2%19 20 £33,230 £34,202 £972 3%18 19 £31,715 £33,230 £1,515

16 Aug 2004: Mol. Biol. (2004) 341, 839–852. diverse roles18–20 that include anchoring the ring tothe cell membrane, invagination and constriction,septum formation and peptidoglycan synthesis toyield two separate daughter cells. ... After centrifugation, the

2 Feb 2004: Add reducing agents immediately before use. Minimal medium (per litre):1l M9 medium2ml 1M MgSO4 (2mM)20ml 20% glucose (0.4%)antibiotic(s)1ml vitamins 1000x (see below)10ml trace elements

2 Jun 2004: glass coverslips in 24-well plates were infected with trans-fected parasites and were processed for IF 20 –24 h post-transfection asdescribed (32). ... After 20 min on ice, themembrane fraction was isolated by centrifugation (100,000 rpm for 20min in a

1 Nov 2004: Cells were resuspended in sonication buffer (20 mM Tris [pH 8.0],the Vps25 subunit. ... 20 mM Tris [pH 7.4], 100 mM NaCl, and 2 mM DTT).

29 Dec 2004: Tirnernin) 30 40. B z a’ P ' X- 60. 3, Lc; 5: 40 nei '-YE 20 z. ... A, au- toradiograph of 7.5% SDS PAGE of membrane proteins (20 rg) from each condition.

10 Aug 2004: PE. RS. ON. NE. L D. IVIS. ION. OR. GA. NIS. AT. ION. CH. AR. TA. NN. EX. B(. not. par. t of. the. Div. isio. n bu. t rep. ort t. o th. e D. irec. tor. ofP. erso. nnel. ). Occ. upat. iona. l Hea. lth. D. irec. tor o. fP. erso. nnel. P. eter. Dee. r.

15 Mar 2004: 20]. (c) Suppose that this year, instead of producing the units in-house, the firm. ... 700 20 1360 f c 28 1000 24 1160 g e,f 20 400 18 550.

20 Sep 2004: but a sizeable fraction (20%) of the E1158Q mutantcomplex eluted with a retention volume consistent with Scc1-C Is a Winged Helix Domain. ... Endogenous Scc1-myc18 wasdetectable 20 min after release from G1 arrest.(B) FACScan analysis shows that cells

23 Nov 2004: Mayer, L.D., Hope, M.J., and Cullis, P.R. (1986). Vesicles ofSigma B1502) were resuspended by sonication at 1 mg/ml in 20 variable sizes produced by a rapid extrusion

10 Mar 2004: Disability code Applications Acceptances Success rate %1 206 174 43 42 21 242 16 16 1 4 6 253 20 17 6 4 30 244 11 12 2 3 18 2556 ... 9 4 2 1 22 257 87 70 22 19 25 278 17 16 4 3 24 199 69 80 20 17 29 21T 11 3 27 0 13,254

8 Nov 2004: sharply (B10–20-fold) despite identical levels of TF expres-sion (Figure 1A and B). ... 80. 40. mock Opn PrP Prl 5 10 20. 10 ng SS-TF ng TF.

23 Nov 2004: M). RUES. S ET. AL. ,NA. NO. LET. T.4,. 1969. (20.

3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.

23 Nov 2004: The maximum was selected and each data point was binned and normalised onto a 4-point scale 0 - 20, 20.1 - 40, 40.1 - 60, 60+. ... 5.0 0.4. Amph-P1 FEDNFVP 20.9 2.2. 1.2 0.1 4.83e4 5.1e3. -6.9 0.2.