Search

Search Funnelback University

Search powered by Funnelback
10 results 20 results 50 results
Relevance Date (Newest first) Date (Oldest first) Title (A-Z) Title (Z-A) Distance URL (A-Z) URL (Z-A) Shuffle
151 - 200 of 2,774 search results for TALK:PC53 20 where 0 match all words and 2,774 match some words.

  1. Results that match 1 of 2 words

  2. openmeeting-20-03-09

    https://mcr.caths.cam.ac.uk/static/files/minutes/2008-09/Minutes-2009-03-20-open.pdf
    23 Jul 2009: St. Catharine’s College MCR Open Meeting Friday, 20th March, 2009. Present Doug, Helen, Becky, Julia, Katie, Tom, Amy, Alex, Cat, Gee, Sam, Charlie. 1. Potential College Rent Increases This discussion began with a recap by Doug of the meetings he
    By: ITC

  3. DOI: 10.1126/science.1136985 , 120 (2007); 316Science et al.Maria C.…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Alonso_Science.pdf
    6 Apr 2007: 0 5 10 15 20. 0 5 10 15 20. 0 5 10 15 20-10. ... Themicrotubule plus end is toward the top of thepage. (Left) Cryo-EM map (20).

  4. Microscopy, 2021, 1–6doi:https://doi.org/10.1093/jmicro/dfab023…

    https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/mic21.pdf
    26 Jul 2021: A likely explanation, in line with other structuralevidence [13,20], is that bilayer thickness is modulated primarily bythe properties of the embedded protein, rather than by cholesterol,in regions where the ... Sci. Adv. 7: eabe6204. 20. Norimatsu Y,

  5. Wine list 2024 15.07.24

    https://www.caths.cam.ac.uk/sites/default/files/Fellows%20Members%20Wine%20List%2015.07.24.pdf
    14 Jul 2024: Germany 2008 20.50 16. Dönnhoff Felsenberg Riesling Germany 2010 39.50 31Schloss Reinharthausen, Nussbrunnen Germany 2010 19.75 6Weingut Dr. ... Duero Spain 2018 20.50 44Los Espinos Merlot reserva Spain 2021 11.25 15Carlisle Zinfandel, Papera Ranch USA
    By: Maurizio Viglione

  6. 14821680963433 1..18

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/e21600-download.pdf
    19 Dec 2016: unprecedented, with an overall RMSD of 1.6 Å, despite sequence identity of only 20%. ... 7.5. Fractions containing pure arcadin-1 were concentrated to 15–20 mg/ml using a Centriprep concentra-.

  7. Crystal Screen Lite™ is a complete reagent kit designed ...

    https://www2.mrc-lmb.cam.ac.uk/screens2/pdf/LMB06b.pdf
    26 Jun 2015: 730 ml water 3. • 20 ml 2.0 M Calcium chloride dihydrate (CAS # 10035-04-8, Catalog # HR2-557). • ... 20. 0.2 M Ammonium sulfate, 0.1 M Sodium acetate trihydrate pH 4.6, 12.5% w/v Polyethylene glycol 4,000.

  8. Introduction to Reshaping our Estate 2023 To find out ...

    https://www.em.admin.cam.ac.uk/files/final_rsoe_brochure.pdf
    10 Aug 2023: 20% more space per head than any other Russell Group university (50% more than the average). ... We need to look at how we use our space today and ask ourselves the question: what needs to change over the next 20 years?

  9. Activity 3 – It’s important to note that there ...

    https://myheplus.com/uploads/gDm0wFirpzauJ3oZVQcZHQh108CLVxkTqAObSTmq.pdf
    18 Feb 2019: 2015). Toddlers’ responses to infants’. negative emotions. Infancy, 20, 70-97. Warrier, V., Grasby, K.
    By: Laura Anders

  10. Fact Sheet:UK ESG Screened Index Equity Sub-Fund, Dec2022

    https://www.pensions.admin.cam.ac.uk/files/sei_27.pdf
    10 Jan 2023: 5 Year (%) 2.20 2.07 0.13. Since Inception (%) 6.56 6.54 0.02. ... Anna HayesClient Relationship Manager44 (0) 20 3395 6129. Chris EdwardsClient Relationship Manager44 (0) 20 3395 3932.
    By: SSGA

  11. rep_14_06332_1673441691523

    https://www.pensions.admin.cam.ac.uk/files/sei_21.pdf
    11 Jan 2023: Discrete performance as at 31-Dec-22. Dec-21 – Dec-22. Dec-20 – Dec-21. ... Dec-19 – Dec-20. Dec-18 – Dec-19. Dec-17 – Dec-18. Dec-16 – Dec-17.

  12. pone.0107211 1..10

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/leoa2014.pdf
    3 Sep 2014: Healthcare) in 20 mM Tris, 100 mM NaCl, 1 mM EDTA, 1 mM. ... sucrose, 1 mM EDTA, 20 mM Tris pH 7.6. The cells were stored.

  13. PowerPoint Presentation

    https://www.hr.admin.cam.ac.uk/files/skilled_worker_update_21.03.24.pdf
    21 Mar 2024: Options D and I Immigration Salary List 20% discount from the ‘general threshold’. ... g5)o 20 points for salary alone: o Salary too low for sponsorship – must be.
    By: Graeme Ross

  14. The 11th Cambridge International Conference on Open and Distance ...

    https://www.vhi.st-edmunds.cam.ac.uk/system/files/documents/2005-4-cde.pdf
    7 Dec 2011: Assessment and Evaluation in Higher Education, 20(3), 251-259. Canton, P. and Carusetta, E. ... Assessment and Evaluation in Higher Education, 20(1), 25-36. Jeff, P. and Smart, R.

  15. Department Application Bronze and Silver Award 2 ATHENA SWAN ...

    https://www.equality.admin.cam.ac.uk/files/englishswannov18.pdf
    8 May 2019: 6. 7. 2. 0 5 10 15 20 25 30 35 40 45 50. ... 75. 21. 44. 17. 0% 10% 20% 30% 40% 50% 60% 70% 80% 90%.
    By: Gavin Alexander

  16. db-blackrock-market-advantage-strategy-fund-sterling-factsheet

    https://www.pensions.admin.cam.ac.uk/files/sei_19.pdf
    2 Aug 2022: 20%. 40%. 60%. 80%. 100%. Au. g-1. 9. Oct-. 19. Dec-1. ... 0. Oct-. 20. Dec-2. 0. Feb. -21. Ap. r-2. 1. Ju.
    By: Lapczynski, Susan

  17. Baharnoush AbdiCambridge Bursary Scheme Administrator (Operations)…

    https://www.cambridgestudents.cam.ac.uk/files/sfe_letter_24-25.pdf
    15 Apr 2024: cambridge.bursary@admin.cam.ac.uk www.cambridgestudents.cam.ac.uk/cambridgebursary. 20/03/2024. Student Finance EnglandPO Box 210Darlington.
    By: Alexandra Harford

  18. SFE letter 24-25

    https://www.cambridgestudents.cam.ac.uk/files/sfw_letter_24-25.pdf
    15 Apr 2024: cambridge.bursary@admin.cam.ac.uk www.cambridgestudents.cam.ac.uk/cambridgebursary. 20/03/2024.
    By: ba434

  19. Research Integrity Report / Page 1 of 11 University ...

    https://www.research-integrity.admin.cam.ac.uk/files/ucam_research_integrity_report_2019-20.pdf
    30 Nov 2020: previous years that have continued to be important during 2019-20 are addressed in part two. ... During 2019-20 the RGIO and RGF have been active participants in conferences and workshops organised by the Russell Group and LERU.

  20. Fund FactSheet UK

    https://www.pensions.admin.cam.ac.uk/files/sei_16.pdf
    28 Apr 2023: Benchmark -12.74 -1.02 5.27 7.54 -1.13 2.96 3.74 0.91 7.25 -0.20. ... J.P. Morgan Investment Management - 24% Feb - 2013 Global corporate bond research. Wellington Management International - 20% Jun - 2019

  21. Filament structure and subcellular organization of the bacterial…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Liu_PNAS_crescentin_2024.pdf
    28 Apr 2024: coil (9, 20) (Fig.

  22. Activity 1 This is an exercise on articulatory phonetics, ...

    https://myheplus.com/uploads/RQKSKZPVZD0hZV067TlertERqdDR46JdhPkRZu3u.pdf
    29 Dec 2018: Of these 25. sounds, 20 are non-nasal, and 5 are nasal.
    By: Laura Anders

  23. 4 09.30 Atrium Registration 10.00 Babbage Lecture Theatre Opening ...

    https://www.cctl.cam.ac.uk/files/ctf-2024-agenda.pdf
    16 Apr 2024: 11.00 Break. 11.20 Parallel Session One. Exam Room A&B. Presentations. • Careers Education2.0: a pedagogically sound and inclusive approach Beka Kimberly & Lucy Romijn. • ... 14.50 Transition: 20 minutes. 15.10 Babbage Lecture Theatre. Panel:
    By: kamilah jooganah

  24. Sensory Neurons Arouse C. elegans Locomotion via Both Glutamate and…

    https://www2.mrc-lmb.cam.ac.uk/groups/wschafer/2015-4.pdf
    30 Jun 2015: PLOS Genetics | DOI:10.1371/journal.pgen.1005359 July 8, 2015 1 / 20. a11111. ... 20 mM glucose, 1 mM CaCl2, and 4 mM MgCl2, bubbledwith 5% CO2, 95% O2 at 20C.
    By: Seungwon Choi, Kelsey P. Taylor, Marios Chatzigeorgiou, Zhitao Hu, William R. Schafer, Joshua M. Kaplan

  25. Fact Sheet:All World ESG Screened Index Equity Sub-Fund, Dec2022

    https://www.pensions.admin.cam.ac.uk/files/sei_28.pdf
    11 Jan 2023: Registered No. 2509928. VAT No. 5776591 81. Registered office: 20 Churchill Place, Canary Wharf, London, E14 5HJ. ... Anna HayesClient Relationship Manager44 (0) 20 3395 6129. Chris EdwardsClient Relationship Manager44 (0) 20 3395 3932.
    By: SSGA

  26. Fact Sheet:Global (50/50) ESG Screened Index Equity Sub-Fund, Dec2022

    https://www.pensions.admin.cam.ac.uk/files/sei_22.pdf
    10 Jan 2023: Registered No. 2509928. VAT No. 5776591 81. Registered office: 20 Churchill Place, Canary Wharf, London, E14 5HJ. ... Anna HayesClient Relationship Manager44 (0) 20 3395 6129. Chris EdwardsClient Relationship Manager44 (0) 20 3395 3932.
    By: SSGA

  27. MinCD cell division proteins form alternating copolymeric cytomotive…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ncomms6341.pdf
    6 Dec 2014: ARTICLE. Received 14 Aug 2014 | Accepted 20 Sep 2014 | Published 15 Dec 2014. ... Lysate was cleared by centrifugation at 20,000 gand the supernatant was loaded on a chitin affinity column.
    By: Debnath Ghosal, Daniel Trambaiolo, Linda A. Amos, Jan Löwe

  28. Structure of bacterial tubulin BtubA�B:Evidence for horizontal gene…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/btubab%202005.pdf
    21 Jun 2005: and size-exclusion chromatography (S300 Sephacryl,Amersham Pharmacia; 20 mM TrisHCl1 mM azide1 mMEDTA, pH 7.5). ... After 30 min at room temperature, samples werecentrifuged at 80,000 rpm for 20 min at 20C in a TLA100 rotor(Beckman).

  29. Cambridge University Reporter No 6706, Wednesday 28 June 2023, Vol…

    https://www.reporter.admin.cam.ac.uk/reporter/2022-23/weekly/6706/6706.pdf
    4 Jul 2023: End of the Official Part of the ‘Reporter’ Report of Discussion: 20 June 2023. ... 20. A candidate for Part I shall offer: (a) one language from Paper A1; (b) either Paper A2 or Paper A3; and (c) three other papers chosen from Group A; provided
    By: University of Cambridge

  30. httDownloaded from rsif.royalsocietypublishing.org ResearchCite this…

    https://www2.mrc-lmb.cam.ac.uk/groups/wschafer/2015-1.pdf
    4 Feb 2015: 20 30. 0 10time (s). 20 30. 0 10time (s). 20 30 0 10time (s). ... 20 30 0 10time (s). 20 30. 0 10time (s). 20 30 0 10time (s).

  31. What Causes Neurodegeneration? The underlying cause of most…

    https://myheplus.com/uploads/qagDQFJGR8rqPidgphxYz6gdC2q5AbCSmFm6n1IT.pdf
    15 Sep 2017: Some people may survive up to 20 years however the average survival of an AD sufferer is just 8 years.
    By: Laura Anders

  32. Department Application Bronze and Silver Award 2 ATHENA SWAN ...

    https://www.equality.admin.cam.ac.uk/files/musicswannov18.pdf
    6 May 2019: where up to 20% of women achieved Firsts. It is difficult to pin down the reasons. ... 20. Figure 11: MPhil Music Studies Applications 2013/14 - 2018/19. No Data Available.
    By: Louise Atkin

  33. JCSG+ Screen

    https://www2.mrc-lmb.cam.ac.uk/screens2/pdf/LMB12.pdf
    2 Oct 2014: 20 0.2 M Li2SO4 8% PEG 20,000 8% PEG 500 MME. ... 21 0.2 M MgCl2 8% PEG 20,000 8% PEG 500 MME.
    By: Tony Savill

  34. CHURCHILL COLLEGE

    https://www.chu.cam.ac.uk/wp-content/uploads/2022/09/Pink-Book-2022-23-2.pdf
    15 Jul 2024: College Counselling Service ________________________________________________ 20. University Counselling Service ______________________________________________ 20. Finances ______________________________________________________________ 20 UK Bank
    By: Les Pepper

  35. October

    https://www.cambridgestudents.cam.ac.uk/files/pcdc_meeting_dates.pdf
    16 Feb 2024: 23/10 27/11 -----. 15/01 26/02 ----- 22/04 20/05 24/06 -----. English 19/10 30/11 18/01 29/02 02/05 06/06 04/07. ... 04. 17/05 18/05. 26/06 to 29/06. 18/07 to 20/07. Congregations - notes In absence only.
    By: User

  36. Your table of cover for your Optimise Health Plan ...

    https://www.chu.cam.ac.uk/wp-content/uploads/2022/01/Simplyhealth-Table-of-Cover.pdf
    17 Jul 2024: towards everyday expenses if you need to stay. in hospital (up to 20 days/nights).

  37. JCSG+ Screen

    https://www2.mrc-lmb.cam.ac.uk/screens2/pdf/LMB15.pdf
    2 Oct 2014: None None 0.1 M Tris 8.5 1.5 M lithium sulfate 20. ... 8.5. 1.5 M lithium sulfate. 20. 0.1 M sodium chloride. None.
    By: Tony Savill

  38. Manual_CO-311 JBScreen Solubility HTS

    https://www2.mrc-lmb.cam.ac.uk/screens2/pdf/SOLUB.pdf
    19 Mar 2018: In addition, a positive control for precipitation (20% acetonitrile, well# A1) is included in the screen.
    By: reuter

  39. 20 20 c h r i s t ’s ...

    https://alumni.christs.cam.ac.uk/file/2020-Magazine.pdf
    24 Sep 2020: 20. 20 c h r i s t ’s c o l l e g e. ... The Annual Report for 2019–20 will be published as usual on the College website in October.

  40. The Alevis The Alevis are the largest non-Sunni religious ...

    https://myheplus.com/uploads/gYvmk0ygg7oJzcw7xvbO1rdLgA3Gim7S5DSAA8gF.pdf
    15 Sep 2017: Their numbers are impossible to ascertain with any accuracy, as they are not recognised in official census data, but it can be assumed that there are between 15-20 million Alevis ... Approximately 15-20% of Turkey’s population is Kurdish. Since the
    By: Hugh

  41. Activity - Tragedy of the Commons The resources on ...

    https://myheplus.com/uploads/UfaA2SdzynCpDqxXNMjgVQr0MCqBZHhwQhpPlyOu.pdf
    1 Oct 2020: carrying capacity (e.g. a patch of land can support 20 cows or one field can feed 10 people).
    By: David Rose

  42. Fact Sheet:Sterling Non-Gilts Bond All Stocks ESG Screened Index…

    https://www.pensions.admin.cam.ac.uk/files/sei_24.pdf
    10 Jan 2023: Registered No. 2509928. VAT No. 5776591 81. Registered office: 20 Churchill Place, Canary Wharf, London, E14 5HJ. ... Anna HayesClient Relationship Manager44 (0) 20 3395 6129. Chris EdwardsClient Relationship Manager44 (0) 20 3395 3932.
    By: SSGA

  43. Nature © Macmillan Publishers Ltd 1998 8 30. Fan, ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsZ.Nature.pdf
    9 Jan 1998: Sequence comparisons between tubulins and FtsZ had alreadyrevealed limited homology of ,10–18% identity7,19,20. ... Proc. Natl Acad. Sci. USA 90, 1053–1057 (1993). 20. de Pereda, J.

  44. MEETING OF THE BOARD OF SCRUTINY

    https://www.clare.cam.ac.uk/sites/default/files/2022-10/Mins%20%28Estates%29%2020%20May%202020.pdf
    18 Nov 2020: Following lockdown,. last week the site had around 20 operatives, with a further six anticipated. ... not factor in any large one off donations. 11. Update on Special Expenditure 2019-20.
    By: user

  45. PNAS202120006_proof

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/pnas%20Lee%202022.pdf
    18 Dec 2022: S2A). ABC-typeATPases bound to ADP.BeF3 often represent the enzyme–substrate complex (20). ... The peak fractionswere concentrated using a Vivaspin 20 100,000-Da centrifugal concentrator andfrozen.

  46. JCR Closed Meeting Minutes 28th April 2023 – 17:00 ...

    https://www.jcr.magd.cam.ac.uk/minutes/28042023
    15 Jun 2023: Committee present: 20. • Rory Gavin (RG) – President. • Nikhil Baid (NB) – Vice-President. •
    By: Oli Hepworth

  47. Many bacterial plasmids are maintained at low copy number ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nrmicro2425.pdf
    14 Sep 2010: There is no ParR or parC present. The scale bar represents 20 nm. ... 20 Macmillan Publishers Limited. All rights reserved10. 7. Simpson, A. E., Skurray, R.

  48. MD1-118 Hippocrates additive screen

    https://www2.mrc-lmb.cam.ac.uk/screens2/pdf/Addit-03.pdf
    9 Jul 2018: C1 13 9 % Pyridoxine hydrochloride C2 14 9 % Thiamine hydrochloride C3 15 9 % CytidineC4 16 6 % Inosine†C5 17 6 % RibavirinC6 18 6 % ThymidineD1 19 6 % UridineD2 20 1.5 %
    By: Molecular Dimensions

  49. Cambridge University Reporter, Friday 20 May 2011

    https://www.reporter.admin.cam.ac.uk/reporter/2010-11/weekly/6225/6225.pdf
    8 Jun 2011: C O N T E N T S. 810 CAMBRIDGE UNIVERSITY REPORTER 20 May 2011. ... 812 CAMBRIDGE UNIVERSITY REPORTER 20 May 2011. The Cambridge University Reporter appears on Wednesdays during Term.
    By: University of Cambridge

  50. mmi_4133.fm

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Spo0J%202004.pdf
    30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG
    By: Yormiar

  51. JCR_Committee_Meeting_Minutes_21st_January_2023

    https://www.jcr.magd.cam.ac.uk/minutes/21012023
    15 Aug 2023:  Cripps, 20 students, 3 or 4 colleges (5 students from each), will be set up like the show.

Refine your results

clear all

Format

Date

Related searches for TALK:PC53 20

By site

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.