Search

11 Nov 2008: HeLa cells that had been serum-starved for 16 hours were stimulated with either EGF (20 ng/ml), TPA (200 ng/ml) or isoproterenol (10 µM) at 37ºC and the activation ... 60. 65. 70. 75. 200 300 400 500 600 700 800 900 1000 1100 12000.

2 Feb 2016: Cambridge, research, neuroscience

2 Jun 2008: R E S E A R C H. HORIZONS. University of Cambridge research magazine www.rsd.cam.ac.ukIssue 6 | Summer 2008. In this issue. SPOTLIGHT ON CHINAplus news and views from across the University. 2 | Issue 6 | Summer 2008. EDITORIAL. ForewordWelcome to

13 Apr 2016: 0. 100. 200. 300. 400. Vid. eo h. its. PlantSci 2014-5. ... 0. 50. 100. 150. 200. Vid. eo h. its. Biochemistry2015-6. (not part of project).

29 May 2015: Waterloo is still news, 200 years later.”. ‘A Damned Serious Business: Waterloo 1815, the Battle and its Books’ runs until 16 September 2015.

11 Nov 2011: Volume 22 May 15, 2011 1625. Cytosolic aggregates perturb the degradation of nontranslocated secretory and membrane proteinsOishee Chakrabarti, Neena S. Rane, and Ramanujan S. HegdeCell Biology and Metabolism Program, Eunice Kennedy Shriver National

1 Mar 2024: CdpB2. SepF. SepFCdpB1. 200. Abso. rban. ce (a. u.). Abso. rban. ... For 1 transformation, 200 µl of the prepared cell suspension was used.

30 Nov 2022: Dr Rishi Rajpopat First published online: 15 December 2022. Copyright Cambridge University Library. In Pānini We Trust:Discovering the Algorithm for Rule Conflict Resolution in the Astādhyāyī’. In Pāṇini We Trust Discovering the Algorithm

6 Apr 2007: on. Apr. il 6,. 200. 7 w. ww. sci. ence. mag. ... REPORTS. on. Apr. il 6,. 200. 7 w. ww. sci. ence.

4 Mar 2015: a total of 2,200 staff.

18 Jan 2007: Program, tasked with measuring the gasdischarge from Erebus. But the challengeis how to make observations of emissionsfrom a 1000 ºC lava lake at the bottom ofa 200-metre-deep crater, at

9 Sep 2008: form all of thebody’s approximately 200 different tissues.The regulatory interaction between stemcells and their local environment (knownas their ‘niche’) works somewhat like apoint-of-sale inventory system thatarranges for

13 Jan 2017: 0 100 200 3001. 1.5. 2. 2.5. Time (s). YFP. /CFP. ... 2.5. YFP. /CFP. rat. io. 0 100 200 300 4001. 1.5.

28 Apr 2024: M446 (M443)F. G. 200 Å. Nanobody. Nanobody. Nanobody. Nanobody. Fig. 2. ... Scale bar, 100 nm.) The Insets (Scale bar, 200 nm.) in A and D show a close- up view of the area outlined by the dashed rectangle.

4 Mar 2019: 150 200 250 300 350 400 450 500. 0. 1. Residue number (S. ... 1. 900 1,000 1,100 1,200. 200 250 300 350 400 450.

17 Mar 2011: University of cambridge research magazine www.research-horizons.cam.ac.uk. issue 14. horizonsRESEARCH. In this issue. the world incambridge. plus news and views from across the University. 2 | Contents. research news 3–5. spotlight: 6–17 the

1 Feb 2008: Thinking Machine

11 Jun 2024: Expenditure 1,363 2,318. Surplus/(deficit) before other gains/losses. 252 200. Net assets 5,663 7,168.

21 May 2024: equipment of £10,200.  The invoice is received and processed in July 2024 however it relates to. ...  New financial year:. 1-Aug-2024 Journal reverses, charging expenditure to dept account £10,200.

13 Jun 2022: 150. 50. 250. mAU. 100. 200. 150. 50. 250. mAU. elution volume (ml)5 1510 20. ... 12.4 mlβ-amylase(200 kDa). 18.9 mlCytochrome c. (12.4 kDa). 17.4 mlCarbonic anhydrase.

7 Mar 2024: 0. 50. 100. 150. 200. 250. 300. 350. Mental Health Neurodiversity Physical Health. ... 0. 100. 200. 300. 400. 500. Home/UK Overseas. Num. ber o.

14 Nov 2021: min). Quantifoil Cu/Rh 200 mesh R2/2 grids. The same Lon. sample, diluted 10 times in buffer A (Lon concentration. ... Tris/HCl pH8.0, 200 mM NaCl, 10 mM MgCl2, 5 mM ATP.

17 Feb 2010: Before theexperiments, proteins were dialysed to 20 mM Tris–HCl, pH 7.5,1 mM EDTA, 1 mM sodium azide, 200 mM NaCl. ... Tris–HCl, pH 9.0, 1 mMEDTA, 1 mM NaN3, 200 mM NaCl, 2 mM TCEP and prespun at138 000 g for 10 min, 41C.

29 Dec 2017: anti-biotin antibody. F 127. catastrophe time. 0. 0.5. 1.0. time (seconds) 200 800. ... of the reaction was pipetted onto freshly glow-dischargedCu/Rh Quantifoil R2/2 200 mesh holey carbon grids (Quantifoil).

15 Jul 2016: The average weight of the crystallized proteins was 37kDa, including large complexes of 100- 200 kDa.

3 Dec 2005: stops when more than 200 pixels are inside the region. The directional dilation forces. ... 200 eggs from a variety of mutant types and recording conditions illustrate the.

10 Nov 2015: Activity 2 - Germany's African Colonies, 1914-1918. Germany was a relative newcomer to the 'scramble for Africa,' spreading into the few unclaimed parts of the continent via mercantile expansion and purchase of territory. By 1914, their colonial

20 Jul 2011: mM Tris pH 7.5, 1 mM EDTA, 1 mM sodium azide and 200 mM NaCl). ... with buffer A being (20 mM Tris pH 8.5, 500 mM NaCl, 1 mM EDTA, 1 mM TCEP) and buffer B (20 mM Tris pH 8.0, 200 mM NaCl,

2 Oct 2014: A good starting point would be 50 µM (10 mg/ml for a 200 kDa protein).

22 Feb 2011: HouseholdIncome Lessthan£25,000. £25,000to£42,000. £42,000to£60,000. Above£60,000 Total Cost(%). Numberof Students 1,350 1,200 1,100 7,350 11,000StandardFee £6,000 £6,000 £6,000 ... £6,000 £6,000AdditionalFee £3,000 £3,000 £3,000 £3,000 £3

27 Oct 2017:  Green & Charities (Heather Rigby): o Plant sale successfully raised 200 GBP for charityo Green & Charity Formal to be held on 8th Nov (GBP 3 per ticket will.

20 Feb 2001: The protein is highlysoluble and stable in 200 mM sodium chloride-containing buffer, and runs as a monomer underthese conditions on size-exclusion columns (datanot shown). ... 20 % (w/v) glycerol,200 mM NaCl, and 0.004 % (v/v) DMSO.

21 Mar 2003: 6. 0 F Glutamate release. 0.1 mM Ca2+. 200 400. Pro. ... Discussion). 0. 600. 800. 400. 200. 1000. Av AvPkCa2+(mM). Ionomycin (µM)30 mM KCl.

2 Apr 2024: For roles defined by all other SOC Codes, the applicant must be in receipt of salary of at least £26,200 or the ‘going rate’ for their role, whichever is higher.

13 Jun 2003: The protein was expressed in C41(DE3) cells and purified by using Ni2-NTA chromatography.After gel filtration (Sephacryl S-200 column in 200 mM NaCl20mM Tris5 mM DTT1 mM EDTA1 ... Themixture was gel filtrated (Sephacryl S-200 column in 20 mMTris5 mM DTT5

9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl,

6 Dec 2014: 200. 250. MinDATP. ATP/ATPγS. EcMinD (D154A): non-polymerising. D155A. minB – minB – slmA–. ... 200. 250. 300. Inte. nsity M. Figure 3 | MinCD filaments bind to membrane and are disassembled by MinE.

7 Mar 2023: Market value of scheme assets: £4,780,200 Scheme liabilities: £5,685,345. Scheme funding shortfall: £905,145 Ongoing funding level: 84%. ... Market value of scheme assets: £4,780,200 Scheme discontinuance liabilities: £8,857,489. Scheme

19 Dec 2016: 200 mM NaCl, 1 mM DTT, 10% glycerol (v/v), 10 mM imidazole, pH 8.0) supplemented with DNase. ... Stock et al., 2005). After optimisation, the best crystals were obtained in 200 nl drops composed.

30 Jun 2004: Spo0J] (mM)0 25 50 100 200 300 25 50 100 200 300. ... The protein was buffer exchanged into20 mM Tris, pH 8.5, 200 mM NaCl using a Sephadex G25 gelfiltration column (Amersham).

3 Sep 2014: 37uC. At mid-exponential growth phase, 200 ml of cell culturewere transferred to 1 ml of cold methanol and kept at 220uC forat least 60 min. ... Invitrogen) at a 1:200 dilution. Cells were observed using a Leica.

29 May 2019: A) Cells expressing GFP-PrP and GFP-PrP were incubated on. ice with 200 nM extracellular Alexa647-conjugated Nb and Alexa647 fluorescence was measured by flow cytometry. ... pro. port. ion o. f cells. time (min). 0 50 100 150 200.

12 Nov 2009: TEN 200 is a buffer containing 20 mM Tris, 1 mM ethylenediaminetetraacetic acid (EDTA), 1 mM sodium azide and 200 mM sodium chloride. ... 1998) G04 oCNVA Concanavalin A 7.0 26.5 Sigma, L7647 Dissolved in TEN 200.

19 Nov 2004: sZ-N. TmFt. sZ-C. TmFt. sZ-N. C. TmFtsZ TmFtsZ-N. TmFtsZ-C TmFtsZ-NC. Wavelength (nm)200 210 220 230 240 250 260. ... 081% (w/v) malachite green and 2 ml of water were mixed and 200 µl was added to 50-µl reactions contain-ing proteins or inorganic

18 Dec 2022: The cell pellet was resuspended in 1 pellet volume of Buffer A (50 mMTrisHCl, pH 8.0, 200 mM NaCl, 5% glycerol, and 5 mM 2-mercaptoethanol)with protease inhibitors (Roche) ... The incubated samples were supplemented with 0.1% (wt/vol)β-octyl glucoside

26 Jun 2024: ancestor which existed over 200. million years ago. This conclusion. was drawn as a result of the.

22 Aug 2023: JO: Asking 200 pounds for kit. No further objections - bid finalised at £544.

26 Nov 2015: E12 Tetraethylene glycol, 80% v/v. F1 PEG 200, 20% v/v. F2 PEG 200, 40% v/v. ... F3 PEG 200, 80% v/v. F4 Pentaethylene glycol, 20% v/v. F5 Pentaethylene glycol, 40% v/v.

1 Jul 2022: 909 949 631 5328 939.4101-150 321 316 343 307 323 160 1770 322151-200 141 127 124 120 143 51 706 131201-250 66 61 60 62 64 25 ... 10%. 20%. 30%. 40%. 50%. 60%. 70%. 80%. 90%. 100%. 0-50 51-100 101-150 151-200 201-250 251-300 301-350 351-400 >400. %

18 Mar 2024: Write a. short description (around 200 words) of each manuscript. Make use of the information that you can find.