Search
Search Funnelback University
- Refined by:
- Date: 2004
- Format: pdf
1 -
50 of
132
search results for TALK:PC53 20
where 0
match all words and 132
match some words.
Results that match 1 of 2 words
-
A-nsmb855.indd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nsmb%20FtsZ%202004.pdf19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture. -
mmi_4133.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Spo0J%202004.pdf30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/ford01.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/epsin/EM/ford.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
53091 361..366
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/McMahon01020.pdf3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al. -
Finance 2004 - 72458.qk
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/08/a-e.pdf12 Jan 2004: 3 — 3 1 27 — — 27 28 39 39 76 110 — 186 116 127 134 — 261 141 330 174 — 20 — 20 11 161 139 — 300 409 356 468 — — — — — — — — — — — —— 22 — 22 13 149 ... 20 20 21Computer Laboratory 2,080 337 48 2,465 2,296 20 -
75934 Student Number 2004
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/19/studentnumber2004.pdf23 Aug 2004: Criminology 8 14 22 — — —M.Phil. Development Studies 20 23 43 — — —M.Phil. ... Philosophy of ScienceHistory and Philosophy of Science 24 20 44 8 5 13. -
32 CAMBRIDGE UNIVERSITY REPORTER [SPECIAL NO. 9 M. S. ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/09/2.pdf22 Jan 2004: PWF Club locationsChemical Engineering 10 16 34 220Economics 4 7 22 85Law 2 5 95 20. ... 5 168 118Photoshop for Photographers: basic 1 19Photoshop: further techniques 5 1 92 20. -
mmi_3991.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ftsn2004.pdf15 Apr 2004: Amersham) in 20 mMNa-Phosphate, pH 6.0, 1 mM EDTA, 1 mM DTT. ... Residues 5–75 0.62 0.15 Å(All heavy atoms). Residues 5–75 1.20 0.17 Å. -
Evolving nature of the AP2 a-appendage hubduring clathrin-coated…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/AP2Hub_EMBO2004/AP2Praefcke2004.pdf23 Nov 2004: There are well over 20 proteins implicated in clathrin-. coated vesicle (CCV) assembly. ... 20. 15. 10. 5. 0. 5. Eps15-MD. Epsin1-MD+. Appendage to protein ratio. -
Membrane transport between compartments in eukary-otic cells requires …
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Dynaminreview2004.pdf2 Feb 2004: Dense body. Synapticvesicles10–20 min at 19C. Temperature shift. 2004 Nature Publishing Group. -
doi:10.1016/j.molcel.2004.08.004
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/15350214.pdf24 Sep 2004: substrate and product complexes.Cells were resuspended in buffer A (20 mM Tris pH 7.5 [4C], and100 mM NaCl) and disrupted with a French press. ... B.G.P. was supported by a fellowship from Secretarı́a de EstadoD [20 mM Tris (pH 7.5) (4C), 0.05 M -
doi:10.1016/j.ceb.2004.06.009
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/MillsMcMahonAp2Review.pdf23 Nov 2004: www.sciencedirect.com Current Opinion in Cell Biology 2004, 16:379–391. G-proteins are required for membrane recruitment[18,20,30,31]. ... L. J Cell Biol 1964, 20:313-332. 2. Pearse BM: Coated vesicles from pig brain: purification andbiochemical -
Form PD26: Personal Development Plan
https://www.hr.admin.cam.ac.uk/files/pd26.pdf16 Dec 2004: Signature of Staff Member. Date. Signature of Reviewer. Date. << /ASCII85EncodePages false /AllowTransparency false /AutoPositionEPSFiles true /AutoRotatePages /All /Binding /Left /CalGrayProfile (Dot Gain 20%) /CalRGBProfile (sRGB IEC61966-2.1) -
2002 Applications Acceptances���������������� ������������������ %…
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/12/table2.pdf10 Mar 2004: 959 24Comprehensive School 44,857 53,371 98,228 38,588 86 45,381 85 83,969 25Sixth Form College 16,500 20,495 36,995 14,418 87 17,706 ... West 846 6 219 6Overseas outside UK 2,774 20 414 12London 2,084 15 571 17South East 2,937 21 840 24. -
Structural Insights into Endosomal Sorting Complex Required…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/15044434.pdf24 Sep 2004: Native protein was expressed in C41(DE3) cells. Cells were resuspended in buffer A (20 mM Tris, pH 8.0, 50 mMpotassium phosphate, pH 8.0, and 100 mM NaCl) and ... Fractions con-. taining Vps23 UEV were pooled and diluted with an equal volume ofbuffer C -
se060101051p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/AP180/Ap180_st.pdf3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP -
THE JOURNAL OF BIOLOGICAL CHEMISTRY 0 1990 by The ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/1_Pewitt_EB_JBC_1990a.pdf29 Dec 2004: the saturable component of bumetanide binding, Keq = k-l/k1 = 20 nM, was determined. ... 1 m. 0 IO 20 30 40. Time (min). 0 10 20 30 40 50 60 70 80. -
BAR Domains as Sensors ofMembrane Curvature: TheAmphiphysin BAR…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/PeterBARdomains.pdf?ijkey=TikQO8xVkpUak&keytype=ref&siteid=sci30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m. -
AnnReport Easter04 - 75612
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/17/appendix.pdf5 Aug 2004: Figure 1: Applications for Graduate and Postgraduate Courses 1993–2003. 20 CAMBRIDGE UNIVERSITY REPORTER [SPECIAL NO. ... St Edmund’s College 2 2 2 1 16 4 20 7 6 3 3 1 16 12 25 16. -
TABLE 7.1. Number and percentage of Home applications and ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/12/table7-1.pdf10 Mar 2004: 2003 Applications Acceptances and success rate Total % Men % Women % Total % Men % Women %. Black Caribbean 34 0.3 14 0.2 20 0.4 3 9 3 21 0 0Black African 112 ... 12 24 5 20 7 28Chinese 245 2 133 2 112 2 71 29 36 27 35 31Asian Other 172 2 84 2 88 2 40 23 -
doi:10.1016/j.cub.2004.02.060
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Zimmerberg_McLaughlin2004.pdf17 Mar 2004: The negative surface potential, which isabout –30 mV for a membrane with 20% phos-phatidylserine [8], also attracts clusters of basicresidues on proteins. ... Dill, K.A., and Bromberg, S. (2003). Molecular Driving Forces.(Garland Science), Chapters -
doi:10.1016/j.cub.2004.09.077
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Snx1PeteCullen2004/Snx1PeteCullen2004.pdf23 Nov 2004: 18–. 20, 29–31]. We examined the dynamics of this compart-main [27, 28]. ... Fig-Consistent with previous data [20, 30], SNX1 existedure 5B, data not shown). -
TABLE 3.2. Number of Home acceptances nationally by UCAS ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/12/table3-2.pdf10 Mar 2004: 947 19 12 31180–239 9,901 10,508 20,409 844 754 1,598 1 4 5120–179 2,713 2,524 5,237 27 30 57 0 0 0. ... 20, Level 2 = 10Free standing Mathematics units: A = 20, B = 17, C = 13, D = 10, E = 7. -
2003 Quant. Methods & Ops. Management
https://www.robinson.cam.ac.uk/iar1/teaching/mst_m2_2003.pdf15 Mar 2004: a) From previous years’ sales data, 20% of customers whose air tickets cost between £500 and £2,000 flew business class. ... e 7.20 am 40 10.00 am f 7.35 am 25 2.00 pm. -
2002 Quant. Methods & Ops. Management
https://www.robinson.cam.ac.uk/iar1/teaching/mst_m2_2002.pdf15 Mar 2004: Explain your answer. [17]. Job Demand Current Stock A 10 260 B 15 195 C 40 880 D 2 20 E 5 75 F 80 1280. ... Millenium Lighting estimates a cost of £100 for placing an order, exclusive of purchase cost, and estimates a 20% annual cost of holding inventory -
se060101047p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Itoh%20et%20al.pdf23 Nov 2004: These reactionswere performed in KIN buffer {50 mM Mops ( pH 7.2),100 mM NaCl, 20 mM MgCl2, 0.5 mM ATP, and 2 mCiof [g-32P]ATP}. ... we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals -
rep5965 - 75038
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/weekly/5965/2.pdf3 Jun 2004: 19. Ancient Egypt, 2The practice of religion. Paper E. 20. Ancient Egypt, 3Interconnections. ... L. Alsdorf), pp. 100–13.Sattasa$ ı (ed. A. Weber) stanzas 1–20, 375–95. -
White2004
https://www.trin.cam.ac.uk/download/college-accounts-2004/?wpdmdl=1287&refresh=668e5d6181de7172060604913 Dec 2004: 20,000. Deductible Items in accordance with Statute G, II,4: £11,624,858 at 15%. ... 25,000Health and Safety Regulations. 14,734Kitchens:. Contributions re Junior Members. 20,902Corkage Subsidy. -
White2004
https://www.trin.cam.ac.uk/download/college-accounts-2004/?wpdmdl=1287&refresh=668e635501aa3172060757313 Dec 2004: 20,000. Deductible Items in accordance with Statute G, II,4: £11,624,858 at 15%. ... 25,000Health and Safety Regulations. 14,734Kitchens:. Contributions re Junior Members. 20,902Corkage Subsidy. -
rep5965 - 75038
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/weekly/5965/1.pdf3 Jun 2004: 15, 18, 36.International Law (i): Papers 15, 19, 20, 21, 23, 36. ... R. Lanman, A Sanskrit Reader, pp. 20–44).Kath $asarits $agara, extracts 22–27 (Lanman, pp. -
LectList2004 - 75962
https://www.reporter.admin.cam.ac.uk/reporter/2004-05/special/01/pdfs/nat_sci_2.pdf22 Sep 2004: JONES (Cu). Experimental Approaches: Cells and Molecules. (14, 15,20 Oct.). DR R. ... Twelve lectures, beginning 20 Jan.). Human Genetics, Genomics and Systems BiologyThe same continued. -
rep5970 - 75611
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/weekly/5970/appendix3.pdf21 Jul 2004: 923 £949 2%22 23 £37,187 £37,975 £788 2%21 22 £35,370 £37,187 £1,816 5%20A 21 £34,838 £35,370 £533 2%20 21 ... 202 £35,370 £1,168 3%20 20A £34,202 £34,838 £635 2%19 20 £33,230 £34,202 £972 3%18 19 £31,715 £33,230 £1,515 -
PII: 0896-6273(95)90037-3
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/neuron95.pdf4 May 2004: Only data extending to about 20/ resolution (within the first zero in the contrast transfer function) were used. ... Biochemistry 20, 2181-2191. Conti-Tronconi, B. M., McLane, K. E., Raftery, M. -
30 Apr 2004 18:9 AR AR214-BB33-09.tex AR214-BB33-09.sgm…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/annrev2004.pdf1 May 2004: The best-characterizedsystem in this context is Spo0J fromB. subtilisand 8–10 copies ofcis-actingparSelements situated around 20% of theoriC region (86). ... 20. Cordell SC, L owe J. 2001. Crystal struc-ture of the bacterial cell division regulatorMinD. -
BAR Domains as Sensors ofMembrane Curvature: TheAmphiphysin BAR…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/PeterBARdomains.pdf30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m. -
doi:10.1016/j.jmb.2004.05.031
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/zapa%202004.pdf16 Aug 2004: Mol. Biol. (2004) 341, 839–852. diverse roles18–20 that include anchoring the ring tothe cell membrane, invagination and constriction,septum formation and peptidoglycan synthesis toyield two separate daughter cells. ... After centrifugation, the -
Expression of selenomethionine substituted proteins innon-methionine…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/methods/SeMet%20recipe.doc.pdf2 Feb 2004: Add reducing agents immediately before use. Minimal medium (per litre):1l M9 medium2ml 1M MgSO4 (2mM)20ml 20% glucose (0.4%)antibiotic(s)1ml vitamins 1000x (see below)10ml trace elements -
Transmembrane Domain Modulates Sorting of MembraneProteins in…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/29_Karsten_V_JBC_2004.pdf2 Jun 2004: glass coverslips in 24-well plates were infected with trans-fected parasites and were processed for IF 20 –24 h post-transfection asdescribed (32). ... After 20 min on ice, themembrane fraction was isolated by centrifugation (100,000 rpm for 20min in a -
doi:10.1016/j.devcel.2004.09.003
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/15469844.pdf1 Nov 2004: Cells were resuspended in sonication buffer (20 mM Tris [pH 8.0],the Vps25 subunit. ... 20 mM Tris [pH 7.4], 100 mM NaCl, and 2 mM DTT). -
THE JOURNAL OF BIOLOGICAL CHEMWXXY Vol. 265, No. 34, ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/2_Pewitt_EB_JBC_1990b.pdf29 Dec 2004: Tirnernin) 30 40. B z a’ P ' X- 60. 3, Lc; 5: 40 nei '-YE 20 z. ... A, au- toradiograph of 7.5% SDS PAGE of membrane proteins (20 rg) from each condition. -
2001 Quant. Methods & Ops. Management
https://www.robinson.cam.ac.uk/iar1/teaching/mst_m2_2001.pdf15 Mar 2004: 20]. (c) Suppose that this year, instead of producing the units in-house, the firm. ... 700 20 1360 f c 28 1000 24 1160 g e,f 20 400 18 550. -
doi:10.1016/j.molcel.2004.08.030
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Haering%20Mol%20Cell%202004.pdf20 Sep 2004: but a sizeable fraction (20%) of the E1158Q mutantcomplex eluted with a retention volume consistent with Scc1-C Is a Winged Helix Domain. ... Endogenous Scc1-myc18 wasdetectable 20 min after release from G1 arrest.(B) FACScan analysis shows that cells -
rep5972 - 75935
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/weekly/5972/annex_b.pdf10 Aug 2004: PE. RS. ON. NE. L D. IVIS. ION. OR. GA. NIS. AT. ION. CH. AR. TA. NN. EX. B(. not. par. t of. the. Div. isio. n bu. t rep. ort t. o th. e D. irec. tor. ofP. erso. nnel. ). Occ. upat. iona. l Hea. lth. D. irec. tor o. fP. erso. nnel. P. eter. Dee. r. -
TABLE 7.2. Number and percentage of Home applications and ...
https://www.reporter.admin.cam.ac.uk/reporter/2003-04/special/12/table7-2.pdf10 Mar 2004: Disability code Applications Acceptances Success rate %1 206 174 43 42 21 242 16 16 1 4 6 253 20 17 6 4 30 244 11 12 2 3 18 2556 ... 9 4 2 1 22 257 87 70 22 19 25 278 17 16 4 3 24 199 69 80 20 17 29 21T 11 3 27 0 13,254 -
InterPro, progress and status in 2005Nicola J. Mulder1,*, Rolf ...
https://supfam.mrc-lmb.cam.ac.uk/bioinformatics/people/julian_gough/publications/mulder_nar_2005.pdf11 Dec 2004: Received September 20, 2004; Revised and Accepted October 18, 2004. ABSTRACT. ... InterPro release 8.0. contains 11 007 entries, representing 2573 domains,8166 families, 201 repeats, 26 active sites, 21 bindingsites and 20 post-translational modification -
Protection from cytosolic prion protein toxicityby modulation of…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/30_Rane_N_EMBO_2004.pdf8 Nov 2004: sharply (B10–20-fold) despite identical levels of TF expres-sion (Figure 1A and B). ... 80. 40. mock Opn PrP Prl 5 10 20. 10 ng SS-TF ng TF. -
037816S473
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Snx1PeteCullen2004/Carlton2004Supp.pdf23 Nov 2004: Mayer, L.D., Hope, M.J., and Cullis, P.R. (1986). Vesicles ofSigma B1502) were resuspended by sonication at 1 mg/ml in 20 variable sizes produced by a rapid extrusion -
www.sciencemag.org SCIENCE VOL 306 12 NOVEMBER 2004 1103 A ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/AP2Hub_EMBO2004/ScienceHighlight.pdf23 Nov 2004: M). RUES. S ET. AL. ,NA. NO. LET. T.4,. 1969. (20. -
53091 361..366
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/McMahonE.pdf3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.