Search
Search Funnelback University
- Refined by:
- Date: 2011
- Format: pdf
1 -
10 of
21
search results for TALK:PC53 20 |u:www2.mrc-lmb.cam.ac.uk
where 0
match all words and 21
match some words.
Results that match 1 of 2 words
-
Molecular basis for membraneremodelling and organization Deadline for …
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/F-BAR_proteins/Le%20Poster_DEUXNew.pdf29 Sep 2011: Molecular basis for membraneremodelling and organization. Deadline for application is 20 May 2011. -
molcel3956mmc1
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Salje2011Supp.pdf20 Jul 2011: Cells were lysed in buffer A (20 mM Tris pH 8.5, 500 mM NaCl, 0.1 mM EDTA), supplemented with DNase (Sigma) and protease inhibitor tablets (Roche) by passing it ... J Biochem Biophys Methods 67, 67-74. << /ASCII85EncodePages false /AllowTransparency -
Date: 4-5th April 2011 Venue: School of Biosciences, University ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/BirminghamProgram.pdf4 Mar 2011: Recommended Hotels: Menzies Strathallan 225 Hagley Road Birmingham, West Midlands B16 9RY 0121 455 9777 Price range: £50-60 per night Premier Inn Birmingham Broad St (Canal Side) 20 Bridge Street -
373_431_BIOsp_0411
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Biospektrum2011%20Gasper.pdf1 Jul 2011: 2B). BtubA/B bilden in vitro dimere Filamente,die sich zu einem Komplex aus 20 bis 30 Fila-menten bündeln können. -
wordmark_print_b_tranparentBG
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/EMBO_Endocytosis.pdf26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20. -
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20 -
Nouvelles.indd
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Boucrot%20Med%20Sci%20(Paris)%202011.pdf7 Mar 2011: Mol Biol Cell 2009 ; 20 : 3251-60. 19. Ehrlich M, Boll W, Van Oijen A, et al. ... Mol Biol Cell 2009 ; 20 : 4640-51. 31. Frost A, Unger VM, De Camilli P. -
Protein-driven membrane stresses in fusion and fission
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/KozlovCurvature2010.pdf21 Feb 2011: Nat. Rev. Mol. Cell Biol. 7, 9–19. 20 Kozlov, M.M. and Chernomordik, L.V. ... Biochim. Biophys. Acta 1793, 20–26. 70 Peters, C. et al. (2004) Mutual control of membrane fission and fusionproteins. -
Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf23 Sep 2011: Folch liposomes (400 nm).Endophilin N-BAR domain was used at 1, 2, 5, 10, and 20 M. ... A, Averaged capacitance responses to 20 ms depo-larization after dialysis of D. -
Biochem. J. (2011) 440, 185–193 (Printed in Great Britain) ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/ChernomordikBJ2011.pdf15 Nov 2011: andMiTMAB. The reagents were applied either before (for 30 min)or immediately after low pH application (for 20 min). ... Virology 404, 117–126. 20 Dawson, J. C., Legg, J. A. and Machesky, L.
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.