Search

25 Jul 2007: 18:30 Dinner 20:00 Opening event: Concert at Schloß Waldthausen by „Trio con brio“ (piano trio) 22:00 Get together in the „Weinkeller“ of Schloß Waldthausen Thursday, Oct 11th, 2007

13 Dec 2017: Rinse the container of condition with deionized water and 20 % ethanol for reuse. ... 5. Seal the cell culture plate containing the screen with an aluminum sheet and place it back in the -20 C incubator.

13 Oct 2020: Catalogue Number (250 mL). 60% Precipitant Mix 1 40% v/v PEG 500 MME; 20 % w/v PEG 20000. ... MD2-100-82 MD2-250-82. 60% Precipitant Mix 3 40% v/v Glycerol; 20% w/v PEG 4000.

5 Mar 2001: 20], Z = 12.9 with a RMS deviation ofsuperimposed CK of 2.7 Aî over 167 equivalent residues. ... 1995) Trends Biochem. Sci. 20, 478. 480.[24] Huang, W.J., Lindqvist, Y., Schneider, G., Gibson, K.J., Flint,.

2 Oct 2014: pH. 4 5 6 7 8 9. 0. 10. 20. 30.

28 Nov 2006: 100 120. kDa 220. Nosto. c p. ly. sate. M. 0 0 0.2 0.4 0.6 0.8 1.0 1.2 40 80 60 20. ... 60. 40. 0. 20. 80. WT K82A mutant. 0.2 0.4 0.6 0.8 1.0 1.2.

1 Jul 2011: 2B). BtubA/B bilden in vitro dimere Filamente,die sich zu einem Komplex aus 20 bis 30 Fila-menten bündeln können.

28 Sep 2006: The lysate buffer consisted of 50 mM Tris-Cl, 1.25 M sodium chloride, final pH 8.0, the wash buffer of 50 mM Tris-Cl, 500 mM sodium chloride, 20% ... For the phylogenetic tree, 10-20 sequences related to the different classes of dynamin-related proteins

1 Aug 2000: mp. h2-. SH. 3. 100. 80. 60. 40. 20. 0. α-ap. ... 9 62 ' ' $ ($ )M # 111+ 5 D ( #. ; ;20 ) (# , ;G%0 ( ' 7 # 9 7 >1 7 ) ; / 9#; #$ ' ;G%0 % ' 7 ( ( ;G%0 # 9( ' ( 62 7 7 ( 62 ( ) # --&/ #--8/ # ---#. 3 ( ( ( # 3 ( '

8 Jun 2006: Readings were performed at 20 C using an average of 5 scans with buffer subtracted. ... uals. 6.00 10 20Concentration (µM). 0. 20. 40. 60. 80 (k.

19 Apr 2006: 2.2. Linear amplification reaction. 2–20 nM of PCR product was used in a linear amplification reaction with 6–400 pM ofpHis17 (B. ... The protein was purified over a Ni-NTA spin column under native conditions (lanes 3 and 5) and separated on a 10–20

6 Mar 2001: 0 10 20 300. 25. 50. 75. 100. Time (min). WT 500 µM GTP. ... Cellswere xed with 2% paraformaldehyde/1.5% glutaraldehyde in 0.1 M sodium cacodylatefor 20 min at room temperature.

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

21 Jun 2005: and size-exclusion chromatography (S300 Sephacryl,Amersham Pharmacia; 20 mM TrisHCl1 mM azide1 mMEDTA, pH 7.5). ... After 30 min at room temperature, samples werecentrifuged at 80,000 rpm for 20 min at 20C in a TLA100 rotor(Beckman).

2 Oct 2014: 20% Polyethylene Glycol 800019. 30% v/v iso-Propanol20. 25% w/v Polyethylene Glycol 400021. ... 20% w/v Polyethylene Glycol Monomethyl Ether 55047. 2.0 M Magnesium Chloride hexahydrate48.

29 May 2017: 60.005 20.000 1 ADP var_2 PA O3A PB O1B 59.979 20.000 1 ADP var_3 O2A PA "O5'" "C5'" -59.942 20.000 1 ADP ... 20.000 1 ADP var_7 "C5'" "C4'" "C3'" "C2'" -150.000 20.000 3.

9 Jan 2017: The screens are normally stored at -20 C since they are not used regularly and contain volatile and unstable compounds.

4 Nov 2022: struction, using local averaging to combine the three-dimensional data from multiplesubsets (17, 20). ... IUCrJ 4,393–399 (2017). 20. A. Miyazawa, Y. Fujiyoshi, M. Stowell, N.

26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20.

23 Sep 2016: A 1 20 % v/v Acetonitrile (Control of Precipitation). A 2 100 mM MES 5.5 None None.

23 Nov 2004: Mayer, L.D., Hope, M.J., and Cullis, P.R. (1986). Vesicles ofSigma B1502) were resuspended by sonication at 1 mg/ml in 20 variable sizes produced by a rapid extrusion

17 Mar 2004: The negative surface potential, which isabout –30 mV for a membrane with 20% phos-phatidylserine [8], also attracts clusters of basicresidues on proteins. ... Dill, K.A., and Bromberg, S. (2003). Molecular Driving Forces.(Garland Science), Chapters

3 Jul 2013: Eulerangle phi and rot were scanned in a range of 20 around the receptor longaxis estimate. ... J Neurosci 20(2):521–528. 8. Marangi PA, et al. (2001) Acetylcholine receptors are required for agrin-inducedclustering of postsynaptic proteins.

4 Jan 2006: fatty acid-free BSA and 0.01% Triton X-100 with substrate concentrations (20–200 mM LPA) at 25 8C and 37 8C with 14C-labelled oleoyl-CoA (Amersham) at aspecific ... Liposomes made from Folch brain lipid extract at0.2 mg ml21 in 20 mM HEPES pH 7.4, 150

29 Apr 2002: We have previously shown,however, that this parameter is modified by disruption of theexocytotic machinery (19, 20). ... Graham, M. E. & Burgoyne, R. D. (2000) J. Neurosci. 20, 1281–1289.21.

12 Oct 2006: Radiolabeled 20-bp fragmentsthat lacked KOPS (nKOPS) or that contained a single KOPS (sKOPS). ... 50 l culture. NMR buffer was 20 mM potassium phosphate and 150 mM.

21 Mar 2003: Dynamin GTPase assay and sedimentation assayThese assays have been described previously [20,27] and furtherdetails are given in the Supplementary material. ... Multimerised dynamin was then sedimented by ultracentrifuga-tion at 80,000 g for 20 min.

23 Nov 2004: M). RUES. S ET. AL. ,NA. NO. LET. T.4,. 1969. (20.

30 Aug 2001: 1a, b.) The reactions were centrifuged at140,000g in a Beckman TLA100 rotor for 20 min at 20 8C. ... 20. Jones, L. J. F., Carballido-Lopez, R. & Errington, J. Control of cell shape in bacteria: helical, actin-like.

11 Nov 2008: phospho IκB. IκB. YopJ-wt. TNF-α (min) 0 5 10 15 20 0 5 10 15 20. ... YopJ-C172A YopJ-wt. 0 5 10 15 20 0 5 10 15 20 TNF-α (min).

19 Apr 2018: Then, add 20 L of deionized water to the main container of the liquid handler. ... After use, flushing with water and then 20% v/v ethanol solution prevents microbial growth.

16 May 2010: Withsome experience you should be able to get an R-factor of less than 20% in less than30 minutes.

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

3 Sep 2014: Healthcare) in 20 mM Tris, 100 mM NaCl, 1 mM EDTA, 1 mM. ... sucrose, 1 mM EDTA, 20 mM Tris pH 7.6. The cells were stored.

18 Feb 1999: Pig α. Stabilising loop. 10 20 30 40 50 60 70 80 90 100. ... J. Mol. Biol.285, 197-203. 20. Muhlradt, P.F. & Sasse, F. (1997).

12 Nov 2009: 20% w/v PEG 20 000,40% v/v PEG MME 550. 35 Cordell et al. ... 3 Teo et al. (2006). 20% w/v PEG 4000,40% v/v glycerol.

13 Jun 2003: 20) and Trusca et al. (21), using a MBP-SulAfusion or a protein A-SulA fusion, respectively, found SulA doesinhibit the GTPase activity of FtsZ. ... The reservoir was 7.5%polyethylene glycol (PEG) 20,0007.5% PEG monomethyl ether55080 mM sodium formate0.1

3 May 2002: J. Neurosci. 20,8667–8676. e Farsad, K. et al. (2001) Generation of high curvature membranesmediated by direct endophilin bilayer interactions. ... J. Neurosci. 20, 7986–7993. 35 Schikorski, T. and Stevens, C.F. (2001)Morphological correlates of

4 Jan 2024: Nat Struct Mol Biol 20, 641-643. 6. Tourigny, D. S., Fernandez, I.

23 Jan 2009: 3E)in line with earlier experiments (10, 20, 21), butthe resolution of these images is limited. ... Biol. 156, 246. (2006).20. G. Ebersbach, D. J. Sherratt, K. Gerdes, Mol.

30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG

23 Nov 2004: These reactionswere performed in KIN buffer {50 mM Mops ( pH 7.2),100 mM NaCl, 20 mM MgCl2, 0.5 mM ATP, and 2 mCiof [g-32P]ATP}. ... we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals

1 Mar 2024: Abso. rban. ce (a. u.). 50. 00 10 20. Volume (ml)30 0 10 20. ... CdpB2–CdpB1–CdpB1–CdpB2–CdpB2–CdpB1. jMTH1859. B. subtilis YlmCAlphaFold2prediction. Two-fold symmetry. g. i. 20 nm.

19 Dec 2016: unprecedented, with an overall RMSD of 1.6 Å, despite sequence identity of only 20%. ... 7.5. Fractions containing pure arcadin-1 were concentrated to 15–20 mg/ml using a Centriprep concentra-.

17 Feb 2010: Over the past 20 years,. intensive research has given us a glance into how non-. ... and pellet (P) were analysed on a 10–20% SDS gel,stained with Coomassie.

16 May 2010: Withsome experience you should be able to get an R-factor of less than 20% in less than30 minutes.

4 May 2004: Only data extending to about 20/ resolution (within the first zero in the contrast transfer function) were used. ... Biochemistry 20, 2181-2191. Conti-Tronconi, B. M., McLane, K. E., Raftery, M.

19 Jan 2005: At the MRC Laboratory of Molecular Biology (LMB) about 15–20 groups are more or lessintensely involved in protein crystallisation and/or structure determination. ... Our initial idea for long-term storage of the plateswas to store them at 20 1C to

5 Jan 2005: dendrites. Tuba [20], anotherBAR protein, has Rho GEF activity and multiple SH3 domains that binddynamin, N-WASP (neural Wiskott–Aldrich syndrome protein) and otheractin-regulating proteins.

4 Feb 2015: 20 30. 0 10time (s). 20 30. 0 10time (s). 20 30 0 10time (s). ... 20 30 0 10time (s). 20 30. 0 10time (s). 20 30 0 10time (s).