Search

Search Funnelback University

Search powered by Funnelback
11 - 20 of 30 search results for TALK:PC53 20 |u:www2.mrc-lmb.cam.ac.uk where 0 match all words and 30 match some words.
  1. Results that match 1 of 2 words

  2. Molecular basis for membraneremodelling and organization Deadline for …

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/F-BAR_proteins/Le%20Poster_DEUXNew.pdf
    29 Sep 2011: Molecular basis for membraneremodelling and organization. Deadline for application is 20 May 2011.
  3. Date: 4-5th April 2011 Venue: School of Biosciences, University ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/BirminghamProgram.pdf
    4 Mar 2011: Recommended Hotels: Menzies Strathallan 225 Hagley Road Birmingham, West Midlands B16 9RY 0121 455 9777 Price range: £50-60 per night Premier Inn Birmingham Broad St (Canal Side) 20 Bridge Street
  4. 373_431_BIOsp_0411

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Biospektrum2011%20Gasper.pdf
    1 Jul 2011: 2B). BtubA/B bilden in vitro dimere Filamente,die sich zu einem Komplex aus 20 bis 30 Fila-menten bündeln können.
  5. wordmark_print_b_tranparentBG

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/EMBO_Endocytosis.pdf
    26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20.
  6. Protein-driven membrane stresses in fusion and fission

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/KozlovCurvature2010.pdf
    21 Feb 2011: Nat. Rev. Mol. Cell Biol. 7, 9–19. 20 Kozlov, M.M. and Chernomordik, L.V. ... Biochim. Biophys. Acta 1793, 20–26. 70 Peters, C. et al. (2004) Mutual control of membrane fission and fusionproteins.
  7. Biochem. J. (2011) 440, 185–193 (Printed in Great Britain) ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/ChernomordikBJ2011.pdf
    15 Nov 2011: andMiTMAB. The reagents were applied either before (for 30 min)or immediately after low pH application (for 20 min). ... Virology 404, 117–126. 20 Dawson, J. C., Legg, J. A. and Machesky, L.
  8. A Conserved Archaeal Pathway for TailAnchored Membrane Protein…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf
    11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20
  9. Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf
    23 Sep 2011: Folch liposomes (400 nm).Endophilin N-BAR domain was used at 1, 2, 5, 10, and 20 M. ... A, Averaged capacitance responses to 20 ms depo-larization after dialysis of D.
  10. Abstract_Book_HMM_v2

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/conferences/JM_Abstract_Book.pdf
    15 Sep 2011: Daumke. 16:00 --. 19:30. Registration. 16:00 Coffee break. 16:20 Coffee break. ... du réseau neuronal 10:20-10:50 Coffee break - Pause café. Session II.
  11. The life of proteins: the good, the mostly good and the ugly

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/68_Morimoto_RI_NSMB_2011.pdf
    7 Jan 2011: Systematic biochemical studies also elucidated the mechanism by which Ero1-α oxidizes PDI specifically and efficiently among nearly 20 types of PDI-family member proteins.

Refine your results

Format

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.