Search

26 Sep 2011: Isothermal Titration Calorimetry is used to make accurate measurements of affinities and stoichiometries of interactions. It is based on fine measurements of heat changes when ligands interact

20 Jun 2011: 3.00-3.20 p.m. – Refreshment break. 3.20-4.20 p.m. – Hagan Bayley, University of Oxford, “Building prototissues from aqueous droplets”. ... 4.20-5.20 p.m. – Jason Chin, MRC LMB, “Reprogramming the code of life”.

24 May 2011: from the source website: Cambridge First 20 May 2011.

20 Jun 2011: Published on. 20 June, 2011. “In the third of the Biochemical Society’s video interviews with Honorary Members, Tim Hunt talks to Hugh Pelham about discovering the protein that disappeared.”Primary

20 May 2011: Sean Munro elected Fellow of the Royal Society. Published on. 20 May, 2011.

20 Dec 2011: Are the days of incurable diseases really over? Published on. 20 December, 2011.

7 Jun 2011: The Wellcome Trust has appointed 27 Investigators – 7 New Investigators and 20 Senior Investigators – based at institutions across the UK, from London to Liverpool, Edinburgh to Manchester, as well as to

20 Jul 2011: 20 July, 2011. “At the Lindau Nobel Laureate Meeting, 2009 chemistry laureate Thomas Steitz recalled the Laboratory of Molecular Biology at Cambridge in the 1960s, and how informal conversations helped nurture

7 Jul 2011: Individuals with a rare disease called Fanconi Anaemia, which affects around 20,000 people worldwide, do not have the enzymes which repair DNA and are likely to be very sensitive to

20 Jul 2011: Cells were lysed in buffer A (20 mM Tris pH 8.5, 500 mM NaCl, 0.1 mM EDTA), supplemented with DNase (Sigma) and protease inhibitor tablets (Roche) by passing it ... J Biochem Biophys Methods 67, 67-74. << /ASCII85EncodePages false /AllowTransparency

29 Sep 2011: Molecular basis for membraneremodelling and organization. Deadline for application is 20 May 2011.

4 Mar 2011: Recommended Hotels: Menzies Strathallan 225 Hagley Road Birmingham, West Midlands B16 9RY 0121 455 9777 Price range: £50-60 per night Premier Inn Birmingham Broad St (Canal Side) 20 Bridge Street

1 Jul 2011: 2B). BtubA/B bilden in vitro dimere Filamente,die sich zu einem Komplex aus 20 bis 30 Fila-menten bündeln können.

26 Aug 2011: ns. Oral presentation selected from abstracts. 14:15 –16:45 Concurrent session 20.

21 Feb 2011: Nat. Rev. Mol. Cell Biol. 7, 9–19. 20 Kozlov, M.M. and Chernomordik, L.V. ... Biochim. Biophys. Acta 1793, 20–26. 70 Peters, C. et al. (2004) Mutual control of membrane fission and fusionproteins.

15 Nov 2011: andMiTMAB. The reagents were applied either before (for 30 min)or immediately after low pH application (for 20 min). ... Virology 404, 117–126. 20 Dawson, J. C., Legg, J. A. and Machesky, L.

11 Nov 2011: S. cerevisiaeM. thermautotrophicus. 10. 20. 30. 40. 50. 60. 70. H.sapiens MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGR.ESVLIISTDPAHNISDAFDQKFSKVPTKVKGS. ... A data set to 2.1 Å was usedfor model building and refinement with COOT (20

23 Sep 2011: Folch liposomes (400 nm).Endophilin N-BAR domain was used at 1, 2, 5, 10, and 20 M. ... A, Averaged capacitance responses to 20 ms depo-larization after dialysis of D.

15 Sep 2011: Daumke. 16:00 --. 19:30. Registration. 16:00 Coffee break. 16:20 Coffee break. ... du réseau neuronal 10:20-10:50 Coffee break - Pause café. Session II.

7 Jan 2011: Systematic biochemical studies also elucidated the mechanism by which Ero1-α oxidizes PDI specifically and efficiently among nearly 20 types of PDI-family member proteins.

7 Mar 2011: Mol Biol Cell 2009 ; 20 : 3251-60. 19. Ehrlich M, Boll W, Van Oijen A, et al. ... Mol Biol Cell 2009 ; 20 : 4640-51. 31. Frost A, Unger VM, De Camilli P.

21 Feb 2011: For spot dilution assays, overnightcultures grown in YPD were serially diluted 20-fold and spotted onto theappropriate plates. ... Rvs161-Rvs167induced membrane tubule structures with a diameter of18 –20 nm in 15% of the synthetic liposomes

14 Jul 2011: 20) in cultured cells and assessed the levels of aco-expressed MLP substrate. ... Chemical crosslinking experiments were essentiallycarried out as described previously4,20. Chilled translation reactions were layered.

3 May 2011: CHAPTER 6. C2 Domains and Membrane Fusion. Sascha Martens1 and Harvey T. McMahon21 Max F. Perutz Laboratories, University of Vienna, Vienna, Austria2 MRC Laboratory of Molecular Biology, Cambridge, United Kingdom. I. OverviewII. Membrane Fusion. A.

11 Nov 2011: C D. 0. 20. 40. 60. 80. 100. SA-PrPBio. Prl-PrP(G123P)BioPrPBio. PrP(AV3)Bio. ... rPHA. PrPBi. o. PrP2H. A. PrPBi. o. PrP2H. A. cyt-BirA:ER-BirA: - -. - -- -. - -. BirA:[Biotin]:. - - 0 2 5 10 20 50 20 50.

24 Aug 2011: B) 20–25 cells treated as in A were used to calculate the volume fraction (V(v)). ... Bar, 200 nm. (G) Stereology measurements were captured across 20–25 cells in three independent areas as treated in F.

19 Jul 2011: These cargo-specific adaptor proteins always bind the core adaptor AP2 (REFS 20,21) (FIG.

11 Nov 2011: In cells containing mCFP-PrP40–231 aggregates, we observed increased in-tracellular accumulation of CRFR1 in 20% of cells (Table 1; exam-ples in Figure 7). ... 6.0% (8/133). n.d. n.d. 20% (25/128). 6.5% (10/155). None n.d. 3.8% (5/129).

16 Nov 2011: Nature Reviews Molecular Cell Biology, (2011). doi:10.1038/nrm3226

9 Nov 2011: For insertion into the ER, the “ideal”TMD is a 20 residue α-helix composed ofnonpolar, mostly hydrophobic side chains. ... 1996,Heinrich et al. 2000). With further synthesis ofat least 20 residues beyond the TMD, it wouldhave the potential freedom