Search

3 Dec 2005: The onset detection algorithm was tested on 25 videos of 20-minute recordings. ... previously used for the egg detection test and 20 new normal wild type videos.

23 Dec 2013: S4C), suggesting that the interacting α-helices are part of theFtsZ binding site.A Dali structural similarity search (20) revealed that the. ... AnezrA-null mutant forms slightly longer cells (20%) comparedwith wild-type cells (23), but an ftsA null

12 Aug 2006: 50 mM bp), and PaFtsK (20 mM monomer) were mixed in 20 mM. ... ine, and 8% (w/v) PEG 2000. Cryoprotectant: 20% PEG 550 MME in.

9 Nov 2001: Received May 10, 2001; revised version accepted September 20, 2001. Clathrin-mediated endocytosis is a process by whichcells retrieve proteins from the plasma membrane intovesicles. ... 1997) at1:500, anti-RyR (Seok et al. 1992) at 1:20, and Texas-Red

15 Oct 2007: and then incubated with pig brain dynactin complex at 30 1Cfor a further 20 min. ... 20 mg/ml) and 15% v/v heat-inactivated fetal calf serum (Invitrogen,Paisley, UK).

20 Apr 1999: J.Löwe and L.A.Amos. Fig. 1. FtsZ1 fromM.jannaschiiin 20 mM Tris pH 7.5, 1 mM EDTA, 1 mM azide was polymerized for 2–3 h at room ... For polymerization, 8 mM magnesium acetate, 8 mM calcium chlorideand 8 mM (neutralized) GTP were added to FtsZ1 in 20

9 Jan 2003: 20, 2003 213–222http://www.jcb.org/cgi/doi/10.1083/jcb.200208023. ... All GST fu-sion proteins were purified from bacterial extracts by incubation with glu-tathione-Sepharose beads, followed by extensive washing with 20 mMHepes, pH 7.4, 150 mM NaCl,

19 Mar 2018: In addition, a positive control for precipitation (20% acetonitrile, well# A1) is included in the screen.

2 Oct 2014: 18. None. 19. None. 20. 0.1 M HEPES pH 7.521. None22. ... 20% w/v Polyethylene Glycol 335095. 30% w/v Polyethylene Glycol Monomethyl ether 200096.

2 Oct 2014: None None 0.1 M Tris 8.5 1.5 M lithium sulfate 20. ... 8.5. 1.5 M lithium sulfate. 20. 0.1 M sodium chloride. None.

4 Jan 2006: ratio. n (D. 280). 0 10 20. 0.00. 0.05. 0.10. 0.15. ... n (D. 280). 0 5 10. 0.00. 0.10. 0.20. s (Svedbergs).

20 Nov 2003: Crystals were equilibrated in 20% glycerol for cooling to 100K. The crystal asymmetric unit contains one molecule, and the crystals belong to spacegroup P3121, cell dimensions a = b = 49.6Å, c = ... 1mM TCEP. Sedimentation was at 11,000 rev/min, 20.0C,

13 Dec 2017: The advanced setting for ‘max shot vol’ should be lowered from 6,000 to 3,000 when using solutions containing [isopropanol] > 10% v/v and [MPD] > 20% v/v. ... secMAXI 24 200 1.8 2 min 25 secMAXI 48 200 3 4 min 20 sec.

10 Nov 2020: Rank density fit scores,. – Pick top 20 solution, for each of them Rigid body fit and score solutions Pick the highest scoring solution. – ... REFMAC Monomer Library chem_comp_bond. Slide 19. Slide 20. Slide 21. Slide 22.

11 Dec 2017: 3. Then, add 20 L of deionized water to the main container of the liquid handler. ... Disconnect the coupling inserts from the small container (20% ethanol rinsing solution) and connect the inserts to the main container.

8 Aug 2014: centric cohesin structures and an increase of GFP signals in the nucleoplasm after 20.

2 Jun 2007: Samples at different. loading concentrations were sedimented at 10,000 rpm at 20.0 ºC in double sector cells.

5 Jul 2018: A1 Water control -A2 PEG 20000 precipitant 20.00 % w/vA3 PEG 500 MME precipitant 40.00 % w/vA4 PEG 8000 precipitant 20.00 % w/vA5 Ethylene glycol cryoprotectant 40.00 % ... trihydrochloride stabilizer 0.20 MH11 1,4-Diaminobutane dihydrochloride

2 Oct 2014: B2 20% (v/v) PEG 300 100 mM Sodium phosphate dibasic/ Citric acid pH 4.2 200 mM Ammonium sulfate 10% (v/v) Glycerol. B3 50% (v/v) PEG 400 ... 200 mM Sodium chloride. F4 20% (v/v) PEG 300 100 mM Imidazole/ Hydrochloric acid pH 8.0

18 Feb 1999: Pig α. Stabilising loop. 10 20 30 40 50 60 70 80 90 100. ... J. Mol. Biol.285, 197-203. 20. Muhlradt, P.F. & Sasse, F. (1997).

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

20 Apr 2002: Avanti) used at 20 mM, have no effect on cPLA2C2 binding toPC vesicles. ... B, O-phospho-L-serine (Sigma) at 20 mM has no influenceon PC:PE:PS vesicle binding by SytIC2A.

31 Jan 2020: Nat Struct Mol Biol. 19: 492-7. 20) Carter AP‡, Cho C, Jin L, Vale RD‡ (2011) Crystal structure of the dynein motor.

15 Dec 2008: nitrogen cooling, FEI company, Eindhoven, NL) equipped with a Gatan energy filter (filter bandpass 20 eV). ... 18. Figure S4 APlasmid-free control. 19. Figure S4 BPlasmid-free control. 20.

1 Apr 2016: 1. 0.5. 10 20 30 40. dose (electrons/A ). 0.01 0.02 0.03. ... 19] F. Thon, Z. Naturforsch, 21a (1966) 476. [20] S.D. Fuller, Cell 48 (1987) 923.

14 Jan 2002: Kinetic analysis of guanosine 5'-triphosphate hydrolysis associated with tubulin olymerization. Biochemistry 20, 1918-1924, (1981). ... 20.Erickson, H.P., Taylor, D.W., Taylor, K.A. & Bramhill, D. Bacterial cell division protein FtsZ assembles into.

29 Sep 2017: 19. AOM : 1lho. AOM (CSD). 20. AOM : 1lho. AOM (CSD).

3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.

20 Nov 2009: S2I, J). In order to avoid overestimation of the resolution, we applied a mask that was dilated by an additional 20 Å around the structure.

5 Jul 2010: adjusted to pH 8 with KOH. High salt medium was 400mM KCI, 5 mM MgCl2,20 mM triethanolamine chloride, adjusted to pH 8 with KOH. ... Fixation with glutaraldehyde was avoided when uranyl acetate was used. Electron Microscopy and Image

28 Nov 2006: 2000) J Biol Chem 275:36062–36066.20. Jeon KI, Byun MS, Jue DM (2003) Exp Mol Med 35:61– 66.21. ... Twenty-four hours after transfection, cells were serum-starved for 16 h and then stimulated with 20 ng/ml TNF-α.

19 Dec 2017: 1026.595825195, 277.550354004, 267.541595459, 277.006958008, 827.363769531, 1226.079711914, -20.000000000 ). Conclusion Hopefully you are now confident to explore the spliceosome using our PyMOL sessions.

16 Jun 2006: The amino acid sequences deduced from recent cDNA sequences (7, 10, 19, 20) indicate molecular weights of 50,000 (a), 54,000 (/), 56,000 (30, and 58,000 (6), and show ... Nature (Lond.). 299:793-797. 20. Noda, M., H. Takahashi, T. Tanabe, M.

7 Jan 2010: Slide 19. Slide 20. Slide 21. Slide 22. Slide 23. Slide 24.

26 Jul 2023: events. Increase participation by 20%. compared to 2022. symposium. 7 Increase visibility of. ... Gather metrics on. participation. Aim for 20 participants at the. first event.

27 Nov 2003: EMBO J 2001,20:5813-5821. 49. Hinshaw JE: Dynamin and its role in membrane fission.Annu Rev Cell Dev Biol 2000, 16:483-519. ... EMBO J2001, 20:1819-1828. Structural/functional homology between the bacterial and eukaryotic cytoskeletons Amos, van den Ent

3 May 2002: J. Neurosci. 20,8667–8676. e Farsad, K. et al. (2001) Generation of high curvature membranesmediated by direct endophilin bilayer interactions. ... J. Neurosci. 20, 7986–7993. 35 Schikorski, T. and Stevens, C.F. (2001)Morphological correlates of

20 Mar 2018: The locus codesfor the ParMRC system that, besides ParM, contains the DNA-binding protein ParR, and a centromeric sequence parC (19, 20).Principles governing plasmid segregation by the ParMRC systemare well ... J Mol Biol269:505–513. 20. Popp D, et al.

21 Mar 2003: COS cells. (a) (c). (b) (d)Extract incubated with GST–α-adaptin. over 20 cells quantitated (Figure 4a–c) and the blockadewas rescued by coexpression of dynamin. ... Although we have not demonstrated a lack of dynaminrecruitment to coated pits per se,

6 Dec 2014: ARTICLE. Received 14 Aug 2014 | Accepted 20 Sep 2014 | Published 15 Dec 2014. ... Lysate was cleared by centrifugation at 20,000 gand the supernatant was loaded on a chitin affinity column.

6 Jul 1999: Crystallography; CHC proximal legdomain residues 1210 to 1516 (20). 2.6 CHC proximal leg, clathrin LC. ... 20. J. A. Ybe et al., Nature 399, 371 (1999).21. Single-letter abbreviations for the amino acid resi-.

16 Jul 2008: ASCII85EncodePages false /AllowTransparency false /AutoPositionEPSFiles true /AutoRotatePages /All /Binding /Left /CalGrayProfile (Dot Gain 20%) /CalRGBProfile (sRGB IEC61966-2.1) /CalCMYKProfile (U.S.

9 Dec 2016: Slide 19. Slide 20. Slide 21. Slide 22. Slide 23. Slide 24.

30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m.

30 Jun 2015: PLOS Genetics | DOI:10.1371/journal.pgen.1005359 July 8, 2015 1 / 20. a11111. ... 20 mM glucose, 1 mM CaCl2, and 4 mM MgCl2, bubbledwith 5% CO2, 95% O2 at 20C.

30 Sep 2016: The graph shows cell counts from a co-culture assay after 20 generations of growth. ... Biochem Soc. Trans 38, 395–398, doi: 10.1042/BST0380395 (2010).20. Begg, K. J., Dewar, S.

19 Dec 2016: unprecedented, with an overall RMSD of 1.6 Å, despite sequence identity of only 20%. ... 7.5. Fractions containing pure arcadin-1 were concentrated to 15–20 mg/ml using a Centriprep concentra-.

30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG

8 Nov 2014: 20, 431 (2014). 7. S. Zhu et al., PLOS Pathog. 9, e1003592 (2013). ... collectively representing 20% of all genes. in a typical eukaryotic genome.

18 Dec 2008: F) The Saci1373MIM2 (red)/Saci1372 MIT(yellow) interaction isclosely relatedin structurewith the CHMP6 MIM2(green, extended)/VPS4AMIT (gray helices) inter-action (20). ... 19. M. D. Stuchell-Brereton et al., Nature 449, 740 (2007).20. C.