Search

2 Feb 2004: Add reducing agents immediately before use. Minimal medium (per litre):1l M9 medium2ml 1M MgSO4 (2mM)20ml 20% glucose (0.4%)antibiotic(s)1ml vitamins 1000x (see below)10ml trace elements

23 Nov 2004: Mayer, L.D., Hope, M.J., and Cullis, P.R. (1986). Vesicles ofSigma B1502) were resuspended by sonication at 1 mg/ml in 20 variable sizes produced by a rapid extrusion

23 Nov 2004: M). RUES. S ET. AL. ,NA. NO. LET. T.4,. 1969. (20.

17 Mar 2004: The negative surface potential, which isabout –30 mV for a membrane with 20% phos-phatidylserine [8], also attracts clusters of basicresidues on proteins. ... Dill, K.A., and Bromberg, S. (2003). Molecular Driving Forces.(Garland Science), Chapters

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.

23 Nov 2004: 18–. 20, 29–31]. We examined the dynamics of this compart-main [27, 28]. ... Fig-Consistent with previous data [20, 30], SNX1 existedure 5B, data not shown).

2 Jun 2004: glass coverslips in 24-well plates were infected with trans-fected parasites and were processed for IF 20 –24 h post-transfection asdescribed (32). ... After 20 min on ice, themembrane fraction was isolated by centrifugation (100,000 rpm for 20min in a

15 Apr 2004: Amersham) in 20 mMNa-Phosphate, pH 6.0, 1 mM EDTA, 1 mM DTT. ... Residues 5–75 0.62 0.15 Å(All heavy atoms). Residues 5–75 1.20 0.17 Å.

1 May 2004: The best-characterizedsystem in this context is Spo0J fromB. subtilisand 8–10 copies ofcis-actingparSelements situated around 20% of theoriC region (86). ... 20. Cordell SC, L owe J. 2001. Crystal struc-ture of the bacterial cell division regulatorMinD.

1 Nov 2004: Cells were resuspended in sonication buffer (20 mM Tris [pH 8.0],the Vps25 subunit. ... 20 mM Tris [pH 7.4], 100 mM NaCl, and 2 mM DTT).

20 Sep 2004: but a sizeable fraction (20%) of the E1158Q mutantcomplex eluted with a retention volume consistent with Scc1-C Is a Winged Helix Domain. ... Endogenous Scc1-myc18 wasdetectable 20 min after release from G1 arrest.(B) FACScan analysis shows that cells

29 Dec 2004: Tirnernin) 30 40. B z a’ P ' X- 60. 3, Lc; 5: 40 nei '-YE 20 z. ... A, au- toradiograph of 7.5% SDS PAGE of membrane proteins (20 rg) from each condition.

24 Sep 2004: Native protein was expressed in C41(DE3) cells. Cells were resuspended in buffer A (20 mM Tris, pH 8.0, 50 mMpotassium phosphate, pH 8.0, and 100 mM NaCl) and ... Fractions con-. taining Vps23 UEV were pooled and diluted with an equal volume ofbuffer C

23 Nov 2004: The maximum was selected and each data point was binned and normalised onto a 4-point scale 0 - 20, 20.1 - 40, 40.1 - 60, 60+. ... 5.0 0.4. Amph-P1 FEDNFVP 20.9 2.2. 1.2 0.1 4.83e4 5.1e3. -6.9 0.2.

23 Nov 2004: www.sciencedirect.com Current Opinion in Cell Biology 2004, 16:379–391. G-proteins are required for membrane recruitment[18,20,30,31]. ... L. J Cell Biol 1964, 20:313-332. 2. Pearse BM: Coated vesicles from pig brain: purification andbiochemical

15 Jan 2004: The mouse 139A prion strain, originallyisolated after more than 20 passages in mice, was obtained from R. ... In the brains of Tg196 mice in-oculated with prions from Tg2866 mice, sPrPSc(P101L) ac-counted for 20% of total PrP.

24 Sep 2004: substrate and product complexes.Cells were resuspended in buffer A (20 mM Tris pH 7.5 [4C], and100 mM NaCl) and disrupted with a French press. ... B.G.P. was supported by a fellowship from Secretarı́a de EstadoD [20 mM Tris (pH 7.5) (4C), 0.05 M

8 Nov 2004: sharply (B10–20-fold) despite identical levels of TF expres-sion (Figure 1A and B). ... 80. 40. mock Opn PrP Prl 5 10 20. 10 ng SS-TF ng TF.

23 Nov 2004: There are well over 20 proteins implicated in clathrin-. coated vesicle (CCV) assembly. ... 20. 15. 10. 5. 0. 5. Eps15-MD. Epsin1-MD+. Appendage to protein ratio.

21 Dec 2004: Hence, their reliability is limited to situationswhere the minor population represents at least 10 –20% ofthe total amount. ... The somewhat different proportions attributed totranslational effects by the two approaches (20 vs.

30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m.

2 Feb 2004: Dense body. Synapticvesicles10–20 min at 19C. Temperature shift. 2004 Nature Publishing Group.

3 Dec 2004: we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals of AP180-N did not diffractwell). ... 20 November 2000; accepted 18 December 2000. Notch Inhibition of RASSignaling Through MAP

6 Dec 2004: Received for publication, July 20, 2004, and in revised form, August 24, 2004Published, JBC Papers in Press, August 25, 2004, DOI 10.1074/jbc.M408179200. ... 20% of events), in contrast to therecruitment of dynamin-1 to sites of NPY-Venus release

30 Jan 2004: S2A), a neuron-specific guanosine triphos-phatase (GTPase)–activating protein involved inregulated exocytosis (19, 20). ... F) COS-7cells overexpressing rat amphiphysin1 wild-typeand mut1. Scale bar, 20 m.

23 Nov 2004: These reactionswere performed in KIN buffer {50 mM Mops ( pH 7.2),100 mM NaCl, 20 mM MgCl2, 0.5 mM ATP, and 2 mCiof [g-32P]ATP}. ... we solved the structureof the NH2-terminal domain from the closeAP180 homolog, CALM, at 2 Å resolution(19, 20) (crystals

3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al.

19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture.

30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG

15 Apr 2004: JCB. Article. The Journal of Cell Biology, Volume 164, Number 7, March 29, 2004 997–1007http://www.jcb.org/cgi/doi/10.1083/jcb.200312079 997. The organization of engaged and quiescent translocons in the endoplasmic reticulum of mammalian cells.

4 May 2004: Only data extending to about 20/ resolution (within the first zero in the contrast transfer function) were used. ... Biochemistry 20, 2181-2191. Conti-Tronconi, B. M., McLane, K. E., Raftery, M.

29 Dec 2004: the saturable component of bumetanide binding, Keq = k-l/k1 = 20 nM, was determined. ... 1 m. 0 IO 20 30 40. Time (min). 0 10 20 30 40 50 60 70 80.

16 Aug 2004: Mol. Biol. (2004) 341, 839–852. diverse roles18–20 that include anchoring the ring tothe cell membrane, invagination and constriction,septum formation and peptidoglycan synthesis toyield two separate daughter cells. ... After centrifugation, the