Search
Search Funnelback University
- Refined by:
- Date: 2004
- Format: pdf
31 -
35 of
35
search results for TALK:PC53 20 |u:www2.mrc-lmb.cam.ac.uk
where 0
match all words and 35
match some words.
Results that match 1 of 2 words
-
53091 361..366
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/McMahonE.pdf3 Dec 2004: This points to a function ofAP180 in limiting vesicle size (see also refs 13, 20, 21). ... interactions. J. Cell Biol. 155, 193–200 (2001). 20. Zhang, B. et al. -
A-nsmb855.indd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nsmb%20FtsZ%202004.pdf19 Nov 2004: 40Å. FtsZ-tubulin superposition. outside. a b c d e. 20. 04 N. ... A total of 20 mg pure protein was obtained from 12 l of culture. -
JCB Article The Journal of Cell Biology, Volume 164, ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/28_Snapp_EL_JCB_2004.pdf15 Apr 2004: JCB. Article. The Journal of Cell Biology, Volume 164, Number 7, March 29, 2004 997–1007http://www.jcb.org/cgi/doi/10.1083/jcb.200312079 997. The organization of engaged and quiescent translocons in the endoplasmic reticulum of mammalian cells. -
mmi_4133.fm
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Spo0J%202004.pdf30 Jun 2004: 2C by an ª 20 clockwise rotation). The helix–turn–helix motifs are indicated by HTH. ... Spo0JT.therm Spo0J. MSKKNRPTIGRTLNPSILSGFDSSSASGDRVEQVFKLSTGRQATFIEEV.IPPNQVESDTFVDQHNMTAAQAKTTKKNTAAAAQEAAGAAQPSGLGLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPH.MAKGLGKG -
PII: 0896-6273(95)90037-3
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/neuron95.pdf4 May 2004: Only data extending to about 20/ resolution (within the first zero in the contrast transfer function) were used. ... Biochemistry 20, 2181-2191. Conti-Tronconi, B. M., McLane, K. E., Raftery, M.
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.