Search

26 Sep 2011: Researching the reason immune responses are sprroessed during Yersinia infections.

26 Apr 2011: In total, about 200 boxes have been placed in Churchill Archives Centre.

20 Jul 2011: mM Tris pH 7.5, 1 mM EDTA, 1 mM sodium azide and 200 mM NaCl). ... with buffer A being (20 mM Tris pH 8.5, 500 mM NaCl, 1 mM EDTA, 1 mM TCEP) and buffer B (20 mM Tris pH 8.0, 200 mM NaCl,

1 Jul 2011: Von großem Vorteil ist dabei diedynamische Instabilität der ParM-Filamente:Die sich schnell wiederholende Abfolge vonFilamentbildung und -zerfall (ungefähr 200-mal schneller als bei Aktin) ermöglicht esParM, nach den Plasmiden zu

11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing

23 Sep 2011: 08907 L’Hospitalet de Llobregat, Spain.J. L. Gallop’s present address: Harvard Medical School, Department of Systems Biology, 200 Longwood Avenue,. ... For tubulationassays, typically 1 mg/ml liposomes (200 nm) were incubated for 10 minwith 10, 20,

24 Aug 2011: Bars, 200 nm. on August 24, 2011. jcb.rupress.orgD. ownloaded from. Published August 16, 2010. ... Bar, 200 nm. (E) NIH3T3 cells transfected with Cdc42-WT or -DN were incubated with CTxB before fractionation.

14 Jul 2011: at 4 uC in a TLS-55 rotor(Beckman), after which 200 ml fractions were removed from the top. ... For shRNA experiments, each well received amixture of 550 ng shRNA plasmid, 200 ng PrP expression plasmid and 50 ng CFPexpression plasmid.

21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003).

19 Jul 2011: 3a). The size of clathri n-coated vesicles depends on the size of its cargo76, with an observed upper limit of about 200 nm external diameter, as in the case of