Search

Search Funnelback University

Search powered by Funnelback
10 results 20 results 50 results
Relevance Date (Newest first) Date (Oldest first) Title (A-Z) Title (Z-A) Distance URL (A-Z) URL (Z-A) Shuffle
111 - 120 of 263 search results for KaKaoTalk:vb20 200 |u:www2.mrc-lmb.cam.ac.uk where 0 match all words and 263 match some words.

  1. Results that match 1 of 2 words

  2. doi:10.1016/j.molcel.2006.07.020

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/HiroseMC2006.pdf
    8 Sep 2006: cold stage in a Philips Tecnai F20 electron microscope operating. at 200 kV.

  3. Collaborative protein filaments

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ghosal_embo_2015.pdf
    4 Jan 2016: polymerisation of FtsA is indispensable for its function. Because in. cells the number of FtsA molecules is low at 200 copies per E.

  4. N402_18f 313..320

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10580505.pdf
    11 Nov 1999: Ras binding domain Nα1 Nα2 Nα3 Nα4 Rβ1 Rβ2 Rα1. 150 160 170 180 190 200 210 220 230 240 250. ... contain one protein molecule in the asymmetric unit.Diffraction data were collected at ESRF beamlines ID2 and ID14-4 at 100K after freezingcrystals in
    By: Mark Humphreys

  5. x96255u149

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11090628.pdf
    20 Apr 2002: a The wortmannin crystal was soaked in 1 mM wortmannin for 50 min.b The LY294002 crystal was soaked in 1 mM LY294002 for 200 min.c The quercetin crystal had ... Agullo, G., Gamet-Payrastre, L., Manenti, S., Viala, C., Rémésy, C.,[pH 7.2], 200 mM

  6. Single‐dose immunisation with a multimerised SARS‐CoV‐2 receptor…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/COVID%20vaccine%202021%201873-3468.14171.pdf
    29 Aug 2021: respectively. Murine 18S primers and probe sequences were. utilised at 400 and 200 nM, respectively. ... bodies: rabbit anti-SARS-CoV NP (Rockland Immuno-. chemicals, Limerick, PA, USA, 200-402-A50), rabbit anti-.

  7. Molecular Cell, Vol. 2, 85–91, July, 1998, Copyright 1998 ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/13_Hegde_RS_MolCell_1998.pdf
    16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine

  8. A Polymerization-Associated Structural Switch in FtsZ That Enables…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mBio-2017-Wagstaff-.pdf
    3 May 2017: All images are at the same magnification (scale bar, 200 nm). ... However, these filaments are not the sameas the open-form filaments, with a much smaller interface buried surface area (BSA) of700 Å2, compared to 1,200 Å2 for 1FOf and PDB

  9. x15959u064

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Reim_Brose2001.pdf
    17 Mar 2003: mEPSC charge, amplitude, and frequency measurements were obtained from at least 200 eventsin 19–28 cells per genotype. ... Scale bar: 200 nm.contribution of asynchronous release (1.1% of the re-(C) Bar diagrams expressing the active zone length,

  10. A Conserved Archaeal Pathway for TailAnchored Membrane Protein…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf
    11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing

  11. 201010176 1..6

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/PNAS-2010-Aylett-TubZ.pdf
    21 Oct 2010: All GTPγS-boundsubunits also retain a Mg2þ ion although only four of 11 GDP-bound subunits do so, despite crystallization with 200 mM MgCl2.When aspartate 64 in H2 is not

Refine your results

clear all

Format

Date

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.