Search

4 May 2004: 510 100 1;0 200 2;0 310 3;0 400 4 ; 0 500.

19 Apr 2002: Insect cell extracts containing defined concentrations of Smc1 as the ligand (five dilutions, ranging from 20nM to 200 nM) were floated over the bound analytes, and association and dissociation kinetics were

30 Apr 2010: ST-D. oc2b. C2AB. 4AGS. T-Do. c2b. C2AB. K23. 7,319. E. 200 400 600 800 1000 12000. ... Neurosci. 25,. 5127 (2005).29. V. Chan-Palay, Z. Anat. Entwicklungsgesch. 134, 200.

19 Nov 2019: Plotted is mean SEM from 4-6 independent biological replicates (dots) with 200-400 analyzed cells per replicate.

4 Jan 2006: 300 nm. 200 nm. 100 nm. b. c. d. and how the lipid and protein components can influence bilayertopology. ... J. Cell Biol. 155, 193–200 (2001). 67. Razzaq, A. et al.

23 Nov 2004: 2H2O buffer containing 20mM sodium phosphate ( pH 6.5), 200 mM NaCl, 2 mM2H10 dithiothreitol, and 0.01% sodium azide.

6 Jun 2014: Bar: 200 nm. (B) Cryo-EM image of a lipid tube. Bar: 20 nm.

19 Jan 2017: vector and a 3’ primer that anneals 200 bp downstream of the stop codon of the open reading frame. ... DTT). During the buffer change, 1:200 of SuperTEV (for His-tagged proteins) or 3C protease (for GST-tagged proteins) were added for overnight

19 Mar 2013: Protein was then eluted by adding PrSc proteaseto the beads and further purified by Superdex 200 gel filtration.Protein Labeling—Proteins were labeled with Alexa dyes. ... J. Cell Biol. 155, 193–200. 22. Takei, K., Slepnev, V. I., Haucke, V., and De

8 Sep 2006: cold stage in a Philips Tecnai F20 electron microscope operating. at 200 kV.

20 Apr 2002: The cell pellet was resus-pended in 200 l of lysis buffer (1% Triton, 150 mM NaCl, 10 mM Tris,pH 7.4, 1 mM EDTA, 1 mM EGTA, 0.2 ... PLC2 was further purified on a heparin-Sepharose column (Am-ersham Biosciences) followed by gel filtration on a Superdex

4 Jan 2016: polymerisation of FtsA is indispensable for its function. Because in. cells the number of FtsA molecules is low at 200 copies per E.

11 Nov 1999: Ras binding domain Nα1 Nα2 Nα3 Nα4 Rβ1 Rβ2 Rα1. 150 160 170 180 190 200 210 220 230 240 250. ... contain one protein molecule in the asymmetric unit.Diffraction data were collected at ESRF beamlines ID2 and ID14-4 at 100K after freezingcrystals in

20 Apr 2002: a The wortmannin crystal was soaked in 1 mM wortmannin for 50 min.b The LY294002 crystal was soaked in 1 mM LY294002 for 200 min.c The quercetin crystal had ... Agullo, G., Gamet-Payrastre, L., Manenti, S., Viala, C., Rémésy, C.,[pH 7.2], 200 mM

29 Aug 2021: respectively. Murine 18S primers and probe sequences were. utilised at 400 and 200 nM, respectively. ... bodies: rabbit anti-SARS-CoV NP (Rockland Immuno-. chemicals, Limerick, PA, USA, 200-402-A50), rabbit anti-.

16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine

17 Mar 2003: mEPSC charge, amplitude, and frequency measurements were obtained from at least 200 eventsin 19–28 cells per genotype. ... Scale bar: 200 nm.contribution of asynchronous release (1.1% of the re-(C) Bar diagrams expressing the active zone length,

3 May 2017: All images are at the same magnification (scale bar, 200 nm). ... However, these filaments are not the sameas the open-form filaments, with a much smaller interface buried surface area (BSA) of700 Å2, compared to 1,200 Å2 for 1FOf and PDB

11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing

21 Oct 2010: All GTPγS-boundsubunits also retain a Mg2þ ion although only four of 11 GDP-bound subunits do so, despite crystallization with 200 mM MgCl2.When aspartate 64 in H2 is not