Search

Search Funnelback University

Search powered by Funnelback
151 - 200 of 263 search results for KaKaoTalk:vb20 200 |u:www2.mrc-lmb.cam.ac.uk where 0 match all words and 263 match some words.
  1. Results that match 1 of 2 words

  2. Cover MRC Case Studies FAW09

    https://www2.mrc-lmb.cam.ac.uk/archive/articles/Reviewing_translation_at_the_MRC.pdf
    15 Apr 2015: independent registered charity established by the Medical. Research Council). 10,200 HCV-infected patients have now been.
  3. Bacterial actin: architecture of the ParMRC plasmidDNA partitioning…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ParMRC%20Salje%202008%20EMBO.pdf
    4 Aug 2008: Plasmid 43:200–204. ParMRC plasmid partitioningJ Salje and J Löwe. The EMBO Journal VOL 27 | NO 16 | 2008 & 2008 European Molecular Biology Organization2238.
  4. Protein targeting and degradation are coupled for elimination of…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/73_Hessa_T_Nature_2011.pdf
    14 Jul 2011: at 4 uC in a TLS-55 rotor(Beckman), after which 200 ml fractions were removed from the top. ... For shRNA experiments, each well received amixture of 550 ng shRNA plasmid, 200 ng PrP expression plasmid and 50 ng CFPexpression plasmid.
  5. Crystal Structures of Bacillus subtilis Lon Protease

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/londumanjmb2010.pdf
    20 Jul 2010: the protease domainof Lon is a 150- to 200-amino-acid-long, highlyconserved region located at the C terminus.
  6. Prokaryotic cytoskeletons: protein filaments organizing small cells

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nrmicro.2017.153.pdf
    18 Jan 2018: Nature Reviews Microbiology, (2018). doi:10.1038/nrmicro.2017.153
  7. THE JOURNAL OF BIOLOGICAL CHEMWXXY Vol. 265, No. 34, ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/2_Pewitt_EB_JBC_1990b.pdf
    29 Dec 2004: Since K-252a is a much more potent kinase inhibitor than H-9, and some non- specific effects were noted at concentrations of H-9 in excess of 200 pM, most ... Aliquots of cpt-CAMP-treated cells were further treated for 10 min with K-252a (20 PM) or H-9
  8. PII: S0969-2126(02)00801-8

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Kent_McMahonOwen2002.pdf
    30 Jul 2002: 24% PEG4000, 100 mMTris (pH 8.0), and 200 mM MgCl2.X-ray diffraction data were collected at 100 K in-house on a rotat- References.
  9. Mechanism of endophilin N-BAR domain-mediated membrane curvature…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/GallopEndophilinEMBO/GallopEndophilin2006.pdf
    8 Jun 2006: 20. –10. 0. 10. 20. 30. 200 210 220 230 240 250Wavelength (nm). ... Binding to 50 nm liposomes (p:pellet; s: supernatant) and tubulation of 200 or 400 nm liposomes(monitored by electron microscopy) are shown.
  10. The structural basis of novel endosome anchoringactivity of KIF16B ...

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/17641687.pdf
    23 Jul 2007: 80. 120. 0 50 100 150 200 250. Res. pons. e (R. ... B. 0. 40. 80. 120. 0 100 200 300. Res. pons.
  11. doi:10.1016/j.cub.2004.09.077

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Snx1PeteCullen2004/Snx1PeteCullen2004.pdf
    23 Nov 2004: Cells were incubated A series of frames depicting a GFP-SNX1-decorated tubule trans-with either 200 ng/ml TxR-EGF (A) or 20 g/ml Alexa568-transferrin (B) porting ... The scale barrepresents 200 nm. pressed at high levels, membrane association of wild-
  12. FtsA forms actin-like protofilaments

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/EMBO2012FtsAPiotr/emboj201276a.pdf
    27 Mar 2012: Crystalswere transferred into the same conditions supplemented with 25%(v/v) PEG 200 before flash freezing.
  13. bic296a

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/EberthBJ4170371.pdf
    24 Jan 2009: Injections ofligand solution (1–3.5 mM) into the calorimetric cell were carriedout at time intervals of 200 s with injection volumes of 8 μl.
  14. x96411u107

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11136978.pdf
    1 Dec 2000: The displacement experiment was carried out by mixing 1 mMcontaining 1mM EDTA and 1mM DTT before addition into the assays.PI3K and 2 mM mant-ATP with 50 or 200 mM ... Equilibriumassay with a final ATP concentration of 200 mM with 1.26 mM MgCl2,and
  15. 4380 | G. J. Doherty et al. Molecular Biology ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Doherty2011/DohertyGRAF_MBC2011.pdf
    17 Jan 2012: For polarized uptake experiments, confluent monolayers of MEFs, grown on 12-mm, round, glass coverslips (Lomb Scientific, Australia) were wounded by scratching with a 200 μl pipette tip. ... An axiovert 200 m SP LSM 510 META confocal laser-scanning micro
  16. Biallelic Variants in ASNA1, Encoding a Cytosolic Targeting Factor of …

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/CircGen_2019.pdf
    1 Dec 2019: 1:400),5 mouse monoclonal anti-N-cadherin (Agilent Technologies #M3616, dilution 1:200), and. mouse monoclonal anti-desmin (Ventana Medical Systems #760-2513, prediluted).
  17. Molecular Biology of the CellVol. 16, 279 –291, January ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/32_Levine_CG_MBC_2005.pdf
    21 Dec 2004: Unless specifically noted otherwise, transfections with Lipo-fectamine 2000 (Invitrogen, Carlsbad, CA) were performed in 96-well plateswith a total of 200 ng of plasmid DNA per well. ... Of this 200 ng, the luciferasereporter plasmid was always kept
  18. Transmembrane topogenesis of a tail-anchoredprotein is modulated by…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/36_Brambillasca_S_EMBO_2005.pdf
    20 Jul 2005: Transmembrane topogenesis of a tail-anchoredprotein is modulated by membrane lipidcomposition. Silvia Brambillasca1, Monica Yabal2,Paolo Soffientini1,5, Sandra Stefanovic3,Marja Makarow2, Ramanujan S Hegde3,and Nica Borgese1,4,1CNR Institute of
  19. The GTPase-Activating Protein GRAF1 Regulates the CLIC/GEEC Endocytic …

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Lundmark_McMahon_GRAF2008.pdf
    28 Nov 2008: Note the protein-. dependent presence of tubular structures. The scale bar represents 200 nm. ... beads (Amersham Biosciences) and gel filtration on a sephacryl S-200 column (Amersham) as previously described [1].
  20. doi:10.1016/j.cell.2006.01.047

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/16615893.pdf
    18 Apr 2006: D) Gel filtration of full-length ESCRT-I, ESCRT-I (D21-Vps37), and ESCRT-I core on a Superdex 200 HR10/30. ... mM Tris [pH 7.5], 200 mM NaCl and 5 mM b-mercaptoethanol).
  21. doi:10.1016/j.str.2008.06.010

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/18786397.pdf
    3 Sep 2008: pH 7.5], 200 mM NaCl, 2 mM b-mercaptoethanol) and finally buffer C again. ... ments were cut as 200 3 400 pixel boxes at 1.25 Å/pixel with a 369 pixel over-.
  22. The Jour nal o f Cel l Bio logy ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/24_Fons_RD_JCB_2003.pdf
    6 Feb 2003: Q-FT and S-FT indicate flowthrough fractions after binding at 200 mM KAc to Q- and S-sepharose, respectively.
  23. Contents of Supplementary Figures Supplementary Figure 1:…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/DaumkeMcMahonEHDNature/Daumke_McMahon_EHD_Sup.pdf
    24 Sep 2007: 66. : 58. : 139. : 68. : 200. α1a β1. • • • • • ... at 10 C in 100 mM HEPES (pH 7.5), 50 mM NaCl, 200 µM CaCl2.
  24. elifesciences.org Szwedziak et al. eLife 2014;3:e04601. DOI:…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsZ_Piotr_eLife_2014.pdf
    31 Dec 2014: elifesciences.org. Szwedziak et al. eLife 2014;3:e04601. DOI: 10.7554/eLife.04601 1 of 22. Architecture of the ring formed by the tubulin homologue FtsZ in bacterial cell divisionPiotr Szwedziak†, Qing Wang†, Tanmay A M Bharat, Matthew Tsim, Jan
  25. 15211199233993 1..45

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MreBHussain2018.pdf
    15 Mar 2018: As the curvature of MreB filaments bound to liposomes is much greater (200 nm diameter.
  26. 2168 | K. von der Malsburg et al. Molecular ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/93_vonderMalsburg-_K_MBC_2015.pdf
    11 Aug 2015: Cultured cells were incubated for 20 min with 50 µg/ml CHX or 200 nM pactamycin (pact.) or left untreated (untr.). ... Sample volume was typically 100 or 200 µl. Eleven fractions were removed from the top, and pelleted material was taken up in the 11th
  27. doi:10.1016/j.ceb.2004.06.009

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/MillsMcMahonAp2Review.pdf
    23 Nov 2004: COP and clathrin-coated vesicle budding: different pathways,common approachesHarvey T McMahon1 and Ian G Mills2. Vesicle and tubule transport containers move proteins and. lipids from one membrane system to another. Newly forming. transport
  28. Molecular Biology of the CellVol. 21, 3054 –3069, September ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/RVS161_MBC2010.pdf
    21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003).
  29. Crystal Structures and Nuclear Magnetic Resonance Studies of the Apo…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/WWWrobots/PDF/Publications/acs.biochem.9b00296.pdf
    31 Jul 2019: A common approach included single dropswith final volumes of 200 nL with a 1:1 ratio (100 nL of proteinand 100 nL of precipitant solution).
  30. The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998 Crystal structure ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Owen_McMahon1998.pdf
    9 Sep 1998: The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998. Crystal structure of the amphiphysin-2 SH3 domainand its role in the prevention of dynamin ringformation. D.J.Owen, P.Wigge, Y.Vallis, J.D.A.Moore,P.R.Evans and H.T.McMahon1. MRC Laboratory of
  31. pq240013132p

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/16_Wilhelm_JE_PNAS_2000.pdf
    10 Nov 2000: 200,000 3 g for 40 min.
  32. Protection from cytosolic prion protein toxicityby modulation of…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/30_Rane_N_EMBO_2004.pdf
    8 Nov 2004: ng TF ng PrP-TF. 5 10 200 Opn. PrP. Prl. ng TF 10 ng SS-TF. ... 200 ngDNA per well.
  33.  The Rockefeller University Press, 0021-9525/97/02/567/15 $2.00The…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/8_Lingappa_JE_JCB_1997.pdf
    3 Feb 1997: 8. C, and 200. m. l fractions were collected. 13 ml Sucrose Gradients. ... d. ). Thispellet was washed twice with 200. m. l of the above nondetergent buffer toremove traces of detergent, and then resuspended.
  34. Nature © Macmillan Publishers Ltd 1998 8 30. Fan, ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsZ.Nature.pdf
    9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl,
  35. Articleshttps://doi.org/10.1038/s41594-019-0196-z A folded…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Burmann%20NSMB%202019%20SI.pdf
    26 Feb 2019: reconstituted in buffer containing 40 mM NaCl, 2 mM MgCl2 (red) and doublet MukBEF (MukBEFD) reconstituted in buffer containing 200 mM NaCl (green).
  36. The structure of bactofilin filaments reveals their mode of membrane…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Deng2019Natmicro.pdf
    26 Aug 2019: a b c. d e f. g h. i. 200 nm crossover distance. ... e (R. U). Time (s). WT. 0. 100. 200. 300. –1 10 14 24.
  37. se060101051p

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/AP180/Ap180_st.pdf
    3 Dec 2004: AP2was dialyzed against 50 mM triethanolamine-KCl,pH 8.0, 200 mM NaCl, 0.2 mM EDTA, 0.1% b-mer-captoethanol, and 0.02% NaN3.
  38. 1202.tif

    https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/jcb84.pdf
    16 Jun 2006: 5) , andthe i r w i dth rema i ned fa i r l y constant (800 - 1 , 200 A).
  39. doi:10.1016/j.molcel.2006.06.019

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Ftsk%20mc%202006.pdf
    12 Aug 2006: agent (200 ml in 700 ml water) was added and Pi release monitored. ... tios of these proteins were mixed (in buffer A plus 200 mM NaCl;.
  40. DOI: 10.1126/science.1135394 , 239 (2007); 317Science et al.Nabil…

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/17626883.pdf
    8 Dec 2007: 150. 200. WT E542K E545K Q546K- - - - p85ni. p110 α. ... 0. 50. 100. 150. 200. 250. - - Phosphopeptide. C. B.
  41. d402_16g 822..826

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/15_Hegde_RS_Nature_1999.pdf
    9 Dec 1999: sym. pto. mat. ic. Age (days)200 400 600 800. c. b(A. ... 80. 60. 40. 20. 00 100 200 300 400. (A117V) H(STE).
  42. doi:10.1016/j.str.2007.05.002

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/FCH02F-BARHenne07.pdf
    2 Jun 2007: a Superdex 200 column; 130 mM mFCHo2 (res-. idues 1–261) was loaded. ... H) Control Folch fraction 1 liposomes without addition of protein. The scale bars represent 200 nm.
  43. Activation of Xer-recombination at dif: structural basis of the…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/srep33357.pdf
    30 Sep 2016: Crystallization and data collection for XerDC-FtsKγ. Initial hits were identified using 200 nl protein drops, using commercial screens (Molecular Dimensions) mixed by Mosquito nano-litre robot (TTP Labtech).
  44. doi:10.1016/j.pbiomolbio.2004.07.009

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/stock2005robot.pdf
    19 Jan 2005: available: the IMPAX and ORYX systems from Douglas Instruments Ltd., UK, and theCyberlab 200, distributed by Gilson Inc., USA.
  45. Molecular Biology of the CellVol. 8, 2003–2015, October 1997 ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/WiggeKohler_McMahon1997.pdf
    10 Oct 1997: Interestingly, although P2 (200 mM)efficiently blocks the Amph1– dynamin interaction, thebinding of Amph2 SH3 domain is much less wellinhibited (Figure 4B). ... GST-tagged SH3 domains were incubated as in A but in thepresence or absence of each of the
  46. BIO CHEM ISTR Y Structure of the SARS-CoV-2 RNA-dependent ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/SARS%20polym%202021%20e2021946118.full.pdf
    29 Aug 2021: 200 mM NaCl, 2 mM MgCl2,and 1 mM Tris(2-carboxyethyl)phosphine (TCEP). ... fast, direct-electron detector (Falcon 4,248 Hz), allowed us to acquire more than 200 micrographs per hour for 14 con-secutive days.
  47. CAN-11-2008 3642..3651

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/79_Basseville_A_CanRes_2012.pdf
    24 Sep 2015: Valproic acidinduced the weakest effect on mRNA and protein ABCG2expression (150%–200% increase). ... 100. 150. 200. 250. 300. 350. 400. 450. 500WT Q141K WT Q141K WT Q141K.
  48. doi:10.1016/j.jmb.2007.08.056

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Oliva_FtsZ_JMB_2007.pdf
    11 Oct 2007: After precipitation in 30% ammonium sulfate saturationand anion-exchange chromatography, the protein wasdialyzed against 50 mM Tris–HCl (pH 8.0), 200 mM KCl,1 mM EDTA, 10% (v/v) glycerol ... Drops were composed of100 nl of protein at 10.0 g/l (with 8
  49. Catalytic Domain of Phosphoinositide-specificPhospholipase C…

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/9565585.pdf
    20 Apr 2002: 21 ions. Enzyme(200 ng) was added to the subphase, via an injection port in the Teflontrough, 5 min after the monolayer was spread to allow the surfacepressure to stabilize. ... Replacement of these residues byalanine resulted in a great reduction of the
  50. Protocol for dragonfly

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/WWWrobots/PDF/Manuals/protocols_for_dragonfly.pdf
    13 Dec 2017: secMAXI 24 200 1.8 2 min 25 secMAXI 48 200 3 4 min 20 sec.
  51. ESMS of membrane proteins

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/methods/ESMS%20of%20membrane%20proteins.pdf
    20 Jul 2007: mix - add 200 μl water, mix vigorously - centrifuge 2 min 10.000x g - take top phase off ( 500 μl), protein forms precipitated layer - add 300 μl methanol - centrifuged 1 min

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.