Search
Search Funnelback University
- Refined by:
- Format: pdf
101 -
150 of
263
search results for KaKaoTalk:vb20 200 |u:www2.mrc-lmb.cam.ac.uk
where 0
match all words and 263
match some words.
Results that match 1 of 2 words
-
PII: S1097-2765(02)00515-4
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/SMC%20cohesin%20paper%202002.pdf19 Apr 2002: Insect cell extracts containing defined concentrations of Smc1 as the ligand (five dilutions, ranging from 20nM to 200 nM) were floated over the bound analytes, and association and dissociation kinetics were -
Doc2b Is a High-Affinity Ca2+ Sensor forSpontaneous Neurotransmitter…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/GroffenScience2010.pdf30 Apr 2010: ST-D. oc2b. C2AB. 4AGS. T-Do. c2b. C2AB. K23. 7,319. E. 200 400 600 800 1000 12000. ... Neurosci. 25,. 5127 (2005).29. V. Chan-Palay, Z. Anat. Entwicklungsgesch. 134, 200. -
PII: 0896-6273(95)90037-3
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/neuron95.pdf4 May 2004: 510 100 1;0 200 2;0 310 3;0 400 4 ; 0 500. -
TTC5 mediates autoregulation of tubulin via mRNA degradation
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/Science_2019.pdf19 Nov 2019: Plotted is mean SEM from 4-6 independent biological replicates (dots) with 200-400 analyzed cells per replicate. -
Insight 1 Dec McMahon NS
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/NatureReview2005.pdf4 Jan 2006: 300 nm. 200 nm. 100 nm. b. c. d. and how the lipid and protein components can influence bilayertopology. ... J. Cell Biol. 155, 193–200 (2001). 67. Razzaq, A. et al. -
elifesciences.org van den Ent et al. eLife 2014;3:e02634. DOI: ...
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mrebdouble2014.pdf6 Jun 2014: Bar: 200 nm. (B) Cryo-EM image of a lipid tube. Bar: 20 nm. -
se060101047p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Itoh%20et%20al.pdf23 Nov 2004: 2H2O buffer containing 20mM sodium phosphate ( pH 6.5), 200 mM NaCl, 2 mM2H10 dithiothreitol, and 0.01% sodium azide. -
REPORT◥ PROTEIN HOMEOSTASIS Mechanistic basis for a moleculartriage…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/Science_2017.pdf19 Jan 2017: vector and a 3’ primer that anneals 200 bp downstream of the stop codon of the open reading frame. ... DTT). During the buffer change, 1:200 of SuperTEV (for His-tagged proteins) or 3C protease (for GST-tagged proteins) were added for overnight -
Cooperative Recruitment of Dynamin and BIN/Amphiphysin/Rvs (BAR)…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/JBC_Meinecke2013.pdf19 Mar 2013: Protein was then eluted by adding PrSc proteaseto the beads and further purified by Superdex 200 gel filtration.Protein Labeling—Proteins were labeled with Alexa dyes. ... J. Cell Biol. 155, 193–200. 22. Takei, K., Slepnev, V. I., Haucke, V., and De -
Tyrosine Residues in Phospholipase C�2 Essential for the…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11606584.pdf20 Apr 2002: The cell pellet was resus-pended in 200 l of lysis buffer (1% Triton, 150 mM NaCl, 10 mM Tris,pH 7.4, 1 mM EDTA, 1 mM EGTA, 0.2 ... PLC2 was further purified on a heparin-Sepharose column (Am-ersham Biosciences) followed by gel filtration on a Superdex -
doi:10.1016/j.molcel.2006.07.020
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/HiroseMC2006.pdf8 Sep 2006: cold stage in a Philips Tecnai F20 electron microscope operating. at 200 kV. -
Collaborative protein filaments
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ghosal_embo_2015.pdf4 Jan 2016: polymerisation of FtsA is indispensable for its function. Because in. cells the number of FtsA molecules is low at 200 copies per E. -
N402_18f 313..320
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10580505.pdf11 Nov 1999: Ras binding domain Nα1 Nα2 Nα3 Nα4 Rβ1 Rβ2 Rα1. 150 160 170 180 190 200 210 220 230 240 250. ... contain one protein molecule in the asymmetric unit.Diffraction data were collected at ESRF beamlines ID2 and ID14-4 at 100K after freezingcrystals in -
x96255u149
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11090628.pdf20 Apr 2002: a The wortmannin crystal was soaked in 1 mM wortmannin for 50 min.b The LY294002 crystal was soaked in 1 mM LY294002 for 200 min.c The quercetin crystal had ... Agullo, G., Gamet-Payrastre, L., Manenti, S., Viala, C., Rémésy, C.,[pH 7.2], 200 mM -
Single‐dose immunisation with a multimerised SARS‐CoV‐2 receptor…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/COVID%20vaccine%202021%201873-3468.14171.pdf29 Aug 2021: respectively. Murine 18S primers and probe sequences were. utilised at 400 and 200 nM, respectively. ... bodies: rabbit anti-SARS-CoV NP (Rockland Immuno-. chemicals, Limerick, PA, USA, 200-402-A50), rabbit anti-. -
x15959u064
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Reim_Brose2001.pdf17 Mar 2003: mEPSC charge, amplitude, and frequency measurements were obtained from at least 200 eventsin 19–28 cells per genotype. ... Scale bar: 200 nm.contribution of asynchronous release (1.1% of the re-(C) Bar diagrams expressing the active zone length, -
Molecular Cell, Vol. 2, 85–91, July, 1998, Copyright 1998 ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/13_Hegde_RS_MolCell_1998.pdf16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine -
A Polymerization-Associated Structural Switch in FtsZ That Enables…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mBio-2017-Wagstaff-.pdf3 May 2017: All images are at the same magnification (scale bar, 200 nm). ... However, these filaments are not the sameas the open-form filaments, with a much smaller interface buried surface area (BSA) of700 Å2, compared to 1,200 Å2 for 1FOf and PDB -
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing -
201010176 1..6
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/PNAS-2010-Aylett-TubZ.pdf21 Oct 2010: All GTPγS-boundsubunits also retain a Mg2þ ion although only four of 11 GDP-bound subunits do so, despite crystallization with 200 mM MgCl2.When aspartate 64 in H2 is not -
No Job Name
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MreC%20MM%202006.pdf7 Dec 2006: A pre-culture, grown in 2¥ TY, was used in a1:1000 dilution to inoculate 200 ml of minimal medium con-taining 1¥ M9 supplemented with 0.4% glucose, 2 mMMgSO4, -
Many bacterial plasmids are maintained at low copy number ...
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/nrmicro2425.pdf14 Sep 2010: Many bacterial plasmids are maintained at low copy number (1–5 copies per chromosome equivalent). To prevent plasmid loss at cell division, plasmids have evolved active segregation mechanisms that are loosely analogous to the spindle apparatus in -
pnas201210899 16522..16527
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/PNAS-2012-Aylett-16522-7.pdf12 Oct 2012: Superstructure of the centromeric complex ofTubZRC plasmid partitioning systemsChristopher H. S. Aylett and Jan Löwe1. Medical Research Council Laboratory of Molecular Biology, Division of Structural Studies, Cambridge CB2 0QH, United Kingdom. -
The Acetyltransferase Activity of the Bacterial Toxin YopJ ofYersinia …
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Mittal_JBC2010.pdf4 Oct 2010: Bound material was elutedfrom the resin using 10 ml of 2 N hydrochloric acid, lyophilizedto remove the acid, and taken up in 200 l water. ... time in a 200-l volume using a FluoroMax-2spectrofluorometer (Horiba Yvon Spex). -
The ER membrane protein complex promotes biogenesis of sterol-related …
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/JCS_2019.pdf18 Jan 2019: RESEARCH ARTICLE. The ER membrane protein complex promotes biogenesis ofsterol-related enzymes maintaining cholesterol homeostasisNorbert Volkmar1,, Maria-Laetitia Thezenas2, Sharon M. Louie3, Szymon Juszkiewicz4, Daniel K. Nomura3,Ramanujan S. -
FtsK in motion reveals its mechanism for double-stranded DNA…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsK_Jean_2020_PNAS.pdf8 Jun 2020: ATPɣS (translocating state). A. 0 100 200 300 400 500. 0. -
Activation of GCN2 by the ribosomal P-stalk
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/PNAS_2019.pdf7 Mar 2019: P1P2. GCN2. uL10. A. 200. kDa. 15012010085. 7060. 50. 4030. 25201510. -
M6_07079a2
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/17038310.pdf12 Nov 2006: Briefly, a 1 ml sample of each PX domain was loaded onto a Superdex 200 column (Amersham-Pharmacia) equilibrated and eluted with 20 mM Tris-HCl buffer, pH 7.4, containing -
2623.tif
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/jcb90.pdf23 Jan 2012: raster, different portions o f the image that were between 1,200 and 6,000 A from a reference area were searched for maximum correlation. -
No Job Name
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/vandenent2008ftsq.pdf4 Mar 2008: coli FtsQ and L. monocytogenes FtsQ, in20 mM Tris, 1 mM EDTA, 1 mM NaAzide, 200 mM NaCl,pH 7.0 (TEN200) for Y. -
httDownloaded from rsif.royalsocietypublishing.org ResearchCite this…
https://www2.mrc-lmb.cam.ac.uk/groups/wschafer/2015-1.pdf4 Feb 2015: Finally, we also con-sidered that force generation may be delayed from muscleactivation; we performed parameter sweeps from 0 to 200 ms delay. -
Supplement_Final
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/81_Shao_S_Mol_Cell_2013.pdf16 May 2013: 200 nucleotide poly(A) tail.This suggested stalling of ribosomes after partial translation. ... 200 nt poly(A) tail. 33P-labeled transcripts weregenerated with 33P-UTP (Perkin-Elmer) in transcription reactions. -
Substrate-driven assembly of a translocon for multipass membrane…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/wp-content/uploads/sites/8/2023/08/Nature_2022b.pdf19 Aug 2023: 4c). ΔGapp9.8–0.4–3.7. ΔGapp1. –0.32. –0.33. –3.7. YIPF1(1–200) Sec61β(201–221)N. Flag1 2. YIPF1. ... The 221-residue Flag–YIPF1(1–200)–Sec61β series was generated by Gibson cloning DNA fragments (Twist Biosciences) into a -
Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf23 Sep 2011: 08907 L’Hospitalet de Llobregat, Spain.J. L. Gallop’s present address: Harvard Medical School, Department of Systems Biology, 200 Longwood Avenue,. ... For tubulationassays, typically 1 mg/ml liposomes (200 nm) were incubated for 10 minwith 10, 20, -
npgrj_nchembio_117 691..699
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/18849971.pdf16 Oct 2008: More than 200 analogs of these hits wereiteratively synthesized through diversification of the R1 and R2substituents (Supplementary Table 1). ... We profiled PP121 and PP487against over 200 protein kinases and found that they inhibit a patternof tyrosine -
“The LMB provides an unsurpassed environment for both new ...
https://www2.mrc-lmb.cam.ac.uk/wp-json/wp/v2/pages/www2.mrc-lmb.cam.ac.uk/?wpdmdl=1885218 Jan 2021: 50 Group Leaders. 400 postdoctoral/support scientists. 100 PhD students. 200 support staff. -
Dbouk 1..13
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/vadas_science_signaling.pdf5 Dec 2012: Subsequently, Gb1His-g2 dimers were eluted with abuffer containing 20 mM tris-HCl (pH 8.0), 25 mM NaCl, 0.1% C12E10,200 mM imidazole, and 10 mM 2-ME. ... ME. Gb1His-g2(C68S) mutants were eluted with abuffer containing 20 mM tris-HCl (pH 8.0), 25 mM NaCl, -
ARTICLES ; The structural basis of tail-anchoredmembrane protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/61_Mateja_A_Nature_2009.pdf3 Aug 2009: α5.α9 (130.219). α8.α8 (200.205). D57N. C285S/C288S. WTL9. 4DM. 97D. M10. 0D. ... NADH, and 2 mM Get3 (wild-type or mutant), and reactions were carried out ina final reaction volume of 200 ml. -
refmac keywords
https://www2.mrc-lmb.cam.ac.uk/groups/murshudov/content/refmac/refmac_keywords.pdf12 Jan 2012: Example:occupancy group id 1 chain A # chain A belongs to occupancygroup 1occupancy group id 1 chain B residues from 200 to 500 # all residues between residues200 and 500 of chain ... 150 A atoms C # all atoms with atom namesstarting with C for all -
Structural Analysis of the Interaction between the BacterialCell…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mBio-2018-Kureisaite-Ciziene-e01346-18.full.pdf5 May 2019: ility FtsL. 50 100 150 200 2500.0. 0.2. 0.4. 0.6. 0.8. ... 100. 200. 300. 400FtsB (22-103) FtsN (57-319) vs FtsQ. FtsN (57-319) vs FtsQ. -
Refined Structure of (alpha)(beta)-Tubulin at 3.5 A Resolution
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/jmb%20tubulin%20refinement.pdf3 Nov 2001: In fungi b-tubulin alsohas a phenylalanine at position 202, and accord-ingly residue 167 is an alanine while there is noconsensus for position 200. -
Interaction of tau protein with the dynactincomplex Enrico…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/EMBOJ2007-Magnani-Fan.pdf15 Oct 2007: pred. ictio. n. Arpl binding0. 0.0. 0.5. 1.0. 200 400 600 800 1000 1200. -
Clay_thesis
https://www2.mrc-lmb.cam.ac.uk/groups/wschafer/AnthonyKempf.pdf4 Oct 2005: 1. CHAPTER I: INTRODUCTION. Attempting to deduce the molecular and cellular basis of certain behaviors in higher. organisms such as vertebrates can be a daunting task due to the sheer complexity of neuronal. circuits in these organisms. However, -
S413_6a 39..44
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MreB%20Nature.pdf30 Aug 2001: S8 H4 S9 S10 S11 H5. 200 210 220 230 240 250ER.GYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP.DGQVITIG.NKTYNLMI.GDRTAEAIKMEIGSAE.APEESD.NMEIRGRDLLTGLPKTIEITGKETYRVAI.GERTAERVKIEIGNVF.PSKEND.ELETTVSGIDLSTGLPRKLTLKGG. ... 200 210 220 230 240. H6 H7 S12 S13 -
doi:10.1016/j.devcel.2004.09.003
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/15469844.pdf1 Nov 2004: on Superdex 200 16/60 equilibrated in buffer C. ... A 200–250 g aliquot of GST-tagged pro-taining 3.1% PEG 35000, 0.1 M Tris acetate (pH 8.5), 1.36 M sodiumtein and 600–700 g of -
Structure of a Bacterial Dynamin-like Protein Lipid Tube Provides a…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/cell%202009%20dynamin.pdf19 Dec 2009: 200 kV and a magnification of 59,0003 (pixel size of 1.017 Å prebinning). -
Crystal Structure of the Two N-terminal Domains of g3p from…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10329170.pdf6 May 1999: Thus anunfolding of the hinge sub-domain may expose theTolA-binding site on D1 and release the g3pdomains like beads on a string, allowing them tospan a large distance (> 200 AÊ ) -
PII: S1534-5807(04)00100-5
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Johannes_DevCell2004.pdf22 Mar 2005: Clathrin: 10 nm gold particles. Bar 200 nm.(F) RNAi efficiently down-modulated CHC expression in HeLa cells as detected by Western blot analysis. ... 2002). A systemand 200 nM biotin-Tf for 30 min on ice. -
JCB: Article The Rockefeller University Press $30.00J. Cell Biol. ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/J%20Cell%20Biol%202010%20Howes.pdf24 Aug 2011: Bars, 200 nm. on August 24, 2011. jcb.rupress.orgD. ownloaded from. Published August 16, 2010. ... Bar, 200 nm. (E) NIH3T3 cells transfected with Cdc42-WT or -DN were incubated with CTxB before fractionation. -
Qrb1300006 1..40
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/qrb13.pdf30 Jul 2013: Nicotinic acetylcholinereceptorandthestructuralbasisofneuromuscular transmission:insightsfromTorpedopostsynapticmembranes. Nigel UnwinMRC Laboratory of Molecular Biology, Francis Crick Avenue, Cambridge CB2 0QH, UK. Abstract. The nicotinic
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
- `Sidgwick sites` |u:www.reporter.admin.cam.ac.uk (2) · moments ago
Recent searches
Your search history is empty.