Search
Search Funnelback University
- Refined by:
- Format: pdf
101 -
120 of
263
search results for KaKaoTalk:vb20 200 |u:www2.mrc-lmb.cam.ac.uk
where 0
match all words and 263
match some words.
Results that match 1 of 2 words
-
PII: 0896-6273(95)90037-3
https://www2.mrc-lmb.cam.ac.uk/groups/nu/pdf/neuron95.pdf4 May 2004: 510 100 1;0 200 2;0 310 3;0 400 4 ; 0 500. -
Doc2b Is a High-Affinity Ca2+ Sensor forSpontaneous Neurotransmitter…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/GroffenScience2010.pdf30 Apr 2010: ST-D. oc2b. C2AB. 4AGS. T-Do. c2b. C2AB. K23. 7,319. E. 200 400 600 800 1000 12000. ... Neurosci. 25,. 5127 (2005).29. V. Chan-Palay, Z. Anat. Entwicklungsgesch. 134, 200. -
PII: S1097-2765(02)00515-4
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/SMC%20cohesin%20paper%202002.pdf19 Apr 2002: Insect cell extracts containing defined concentrations of Smc1 as the ligand (five dilutions, ranging from 20nM to 200 nM) were floated over the bound analytes, and association and dissociation kinetics were -
TTC5 mediates autoregulation of tubulin via mRNA degradation
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/Science_2019.pdf19 Nov 2019: Plotted is mean SEM from 4-6 independent biological replicates (dots) with 200-400 analyzed cells per replicate. -
Insight 1 Dec McMahon NS
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/NatureReview2005.pdf4 Jan 2006: 300 nm. 200 nm. 100 nm. b. c. d. and how the lipid and protein components can influence bilayertopology. ... J. Cell Biol. 155, 193–200 (2001). 67. Razzaq, A. et al. -
se060101047p
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Itoh%20et%20al.pdf23 Nov 2004: 2H2O buffer containing 20mM sodium phosphate ( pH 6.5), 200 mM NaCl, 2 mM2H10 dithiothreitol, and 0.01% sodium azide. -
elifesciences.org van den Ent et al. eLife 2014;3:e02634. DOI: ...
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mrebdouble2014.pdf6 Jun 2014: Bar: 200 nm. (B) Cryo-EM image of a lipid tube. Bar: 20 nm. -
REPORT◥ PROTEIN HOMEOSTASIS Mechanistic basis for a moleculartriage…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/Science_2017.pdf19 Jan 2017: vector and a 3’ primer that anneals 200 bp downstream of the stop codon of the open reading frame. ... DTT). During the buffer change, 1:200 of SuperTEV (for His-tagged proteins) or 3C protease (for GST-tagged proteins) were added for overnight -
Cooperative Recruitment of Dynamin and BIN/Amphiphysin/Rvs (BAR)…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/JBC_Meinecke2013.pdf19 Mar 2013: Protein was then eluted by adding PrSc proteaseto the beads and further purified by Superdex 200 gel filtration.Protein Labeling—Proteins were labeled with Alexa dyes. ... J. Cell Biol. 155, 193–200. 22. Takei, K., Slepnev, V. I., Haucke, V., and De -
Tyrosine Residues in Phospholipase C�2 Essential for the…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11606584.pdf20 Apr 2002: The cell pellet was resus-pended in 200 l of lysis buffer (1% Triton, 150 mM NaCl, 10 mM Tris,pH 7.4, 1 mM EDTA, 1 mM EGTA, 0.2 ... PLC2 was further purified on a heparin-Sepharose column (Am-ersham Biosciences) followed by gel filtration on a Superdex -
doi:10.1016/j.molcel.2006.07.020
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/HiroseMC2006.pdf8 Sep 2006: cold stage in a Philips Tecnai F20 electron microscope operating. at 200 kV. -
Collaborative protein filaments
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/ghosal_embo_2015.pdf4 Jan 2016: polymerisation of FtsA is indispensable for its function. Because in. cells the number of FtsA molecules is low at 200 copies per E. -
N402_18f 313..320
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10580505.pdf11 Nov 1999: Ras binding domain Nα1 Nα2 Nα3 Nα4 Rβ1 Rβ2 Rα1. 150 160 170 180 190 200 210 220 230 240 250. ... contain one protein molecule in the asymmetric unit.Diffraction data were collected at ESRF beamlines ID2 and ID14-4 at 100K after freezingcrystals in -
x96255u149
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11090628.pdf20 Apr 2002: a The wortmannin crystal was soaked in 1 mM wortmannin for 50 min.b The LY294002 crystal was soaked in 1 mM LY294002 for 200 min.c The quercetin crystal had ... Agullo, G., Gamet-Payrastre, L., Manenti, S., Viala, C., Rémésy, C.,[pH 7.2], 200 mM -
Single‐dose immunisation with a multimerised SARS‐CoV‐2 receptor…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/COVID%20vaccine%202021%201873-3468.14171.pdf29 Aug 2021: respectively. Murine 18S primers and probe sequences were. utilised at 400 and 200 nM, respectively. ... bodies: rabbit anti-SARS-CoV NP (Rockland Immuno-. chemicals, Limerick, PA, USA, 200-402-A50), rabbit anti-. -
Molecular Cell, Vol. 2, 85–91, July, 1998, Copyright 1998 ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/13_Hegde_RS_MolCell_1998.pdf16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine -
x15959u064
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Reim_Brose2001.pdf17 Mar 2003: mEPSC charge, amplitude, and frequency measurements were obtained from at least 200 eventsin 19–28 cells per genotype. ... Scale bar: 200 nm.contribution of asynchronous release (1.1% of the re-(C) Bar diagrams expressing the active zone length, -
A Polymerization-Associated Structural Switch in FtsZ That Enables…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/mBio-2017-Wagstaff-.pdf3 May 2017: All images are at the same magnification (scale bar, 200 nm). ... However, these filaments are not the sameas the open-form filaments, with a much smaller interface buried surface area (BSA) of700 Å2, compared to 1,200 Å2 for 1FOf and PDB -
A Conserved Archaeal Pathway for TailAnchored Membrane Protein…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing -
201010176 1..6
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/PNAS-2010-Aylett-TubZ.pdf21 Oct 2010: All GTPγS-boundsubunits also retain a Mg2þ ion although only four of 11 GDP-bound subunits do so, despite crystallization with 200 mM MgCl2.When aspartate 64 in H2 is not
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
- `Development and Neuroscience at the University` |u:www.joh.cam.ac.uk (3) · moments ago
- neuroscience |u:www.memlab.psychol.cam.ac.uk (4) · moments ago
- `Fake News` |u:www.joh.cam.ac.uk (12) · moments ago
Recent searches
Your search history is empty.