Search

4 Aug 2008: Plasmid 43:200–204. ParMRC plasmid partitioningJ Salje and J Löwe. The EMBO Journal VOL 27 | NO 16 | 2008 & 2008 European Molecular Biology Organization2238.

24 Aug 2011: Bars, 200 nm. on August 24, 2011. jcb.rupress.orgD. ownloaded from. Published August 16, 2010. ... Bar, 200 nm. (E) NIH3T3 cells transfected with Cdc42-WT or -DN were incubated with CTxB before fractionation.

20 Jul 2010: the protease domainof Lon is a 150- to 200-amino-acid-long, highlyconserved region located at the C terminus.

18 Jan 2018: Nature Reviews Microbiology, (2018). doi:10.1038/nrmicro.2017.153

14 Jul 2011: at 4 uC in a TLS-55 rotor(Beckman), after which 200 ml fractions were removed from the top. ... For shRNA experiments, each well received amixture of 550 ng shRNA plasmid, 200 ng PrP expression plasmid and 50 ng CFPexpression plasmid.

30 Jul 2002: 24% PEG4000, 100 mMTris (pH 8.0), and 200 mM MgCl2.X-ray diffraction data were collected at 100 K in-house on a rotat- References.

29 Dec 2004: Since K-252a is a much more potent kinase inhibitor than H-9, and some non- specific effects were noted at concentrations of H-9 in excess of 200 pM, most ... Aliquots of cpt-CAMP-treated cells were further treated for 10 min with K-252a (20 PM) or H-9

23 Nov 2004: Cells were incubated A series of frames depicting a GFP-SNX1-decorated tubule trans-with either 200 ng/ml TxR-EGF (A) or 20 g/ml Alexa568-transferrin (B) porting ... The scale barrepresents 200 nm. pressed at high levels, membrane association of wild-

23 Jul 2007: 80. 120. 0 50 100 150 200 250. Res. pons. e (R. ... B. 0. 40. 80. 120. 0 100 200 300. Res. pons.

8 Jun 2006: 20. –10. 0. 10. 20. 30. 200 210 220 230 240 250Wavelength (nm). ... Binding to 50 nm liposomes (p:pellet; s: supernatant) and tubulation of 200 or 400 nm liposomes(monitored by electron microscopy) are shown.

27 Mar 2012: Crystalswere transferred into the same conditions supplemented with 25%(v/v) PEG 200 before flash freezing.

24 Jan 2009: Injections ofligand solution (1–3.5 mM) into the calorimetric cell were carriedout at time intervals of 200 s with injection volumes of 8 μl.

1 Dec 2000: The displacement experiment was carried out by mixing 1 mMcontaining 1mM EDTA and 1mM DTT before addition into the assays.PI3K and 2 mM mant-ATP with 50 or 200 mM ... Equilibriumassay with a final ATP concentration of 200 mM with 1.26 mM MgCl2,and

1 Dec 2019: 1:400),5 mouse monoclonal anti-N-cadherin (Agilent Technologies #M3616, dilution 1:200), and. mouse monoclonal anti-desmin (Ventana Medical Systems #760-2513, prediluted).

17 Jan 2012: For polarized uptake experiments, confluent monolayers of MEFs, grown on 12-mm, round, glass coverslips (Lomb Scientific, Australia) were wounded by scratching with a 200 μl pipette tip. ... An axiovert 200 m SP LSM 510 META confocal laser-scanning micro

21 Dec 2004: Unless specifically noted otherwise, transfections with Lipo-fectamine 2000 (Invitrogen, Carlsbad, CA) were performed in 96-well plateswith a total of 200 ng of plasmid DNA per well. ... Of this 200 ng, the luciferasereporter plasmid was always kept

28 Nov 2008: Note the protein-. dependent presence of tubular structures. The scale bar represents 200 nm. ... beads (Amersham Biosciences) and gel filtration on a sephacryl S-200 column (Amersham) as previously described [1].

18 Apr 2006: D) Gel filtration of full-length ESCRT-I, ESCRT-I (D21-Vps37), and ESCRT-I core on a Superdex 200 HR10/30. ... mM Tris [pH 7.5], 200 mM NaCl and 5 mM b-mercaptoethanol).

20 Jul 2005: Transmembrane topogenesis of a tail-anchoredprotein is modulated by membrane lipidcomposition. Silvia Brambillasca1, Monica Yabal2,Paolo Soffientini1,5, Sandra Stefanovic3,Marja Makarow2, Ramanujan S Hegde3,and Nica Borgese1,4,1CNR Institute of

3 Sep 2008: pH 7.5], 200 mM NaCl, 2 mM b-mercaptoethanol) and finally buffer C again. ... ments were cut as 200 3 400 pixel boxes at 1.25 Å/pixel with a 369 pixel over-.

24 Sep 2007: 66. : 58. : 139. : 68. : 200. α1a β1. • • • • • ... at 10 C in 100 mM HEPES (pH 7.5), 50 mM NaCl, 200 µM CaCl2.

6 Feb 2003: Q-FT and S-FT indicate flowthrough fractions after binding at 200 mM KAc to Q- and S-sepharose, respectively.

31 Dec 2014: elifesciences.org. Szwedziak et al. eLife 2014;3:e04601. DOI: 10.7554/eLife.04601 1 of 22. Architecture of the ring formed by the tubulin homologue FtsZ in bacterial cell divisionPiotr Szwedziak†, Qing Wang†, Tanmay A M Bharat, Matthew Tsim, Jan

15 Mar 2018: As the curvature of MreB filaments bound to liposomes is much greater (200 nm diameter.

11 Aug 2015: Cultured cells were incubated for 20 min with 50 µg/ml CHX or 200 nM pactamycin (pact.) or left untreated (untr.). ... Sample volume was typically 100 or 200 µl. Eleven fractions were removed from the top, and pelleted material was taken up in the 11th

23 Nov 2004: COP and clathrin-coated vesicle budding: different pathways,common approachesHarvey T McMahon1 and Ian G Mills2. Vesicle and tubule transport containers move proteins and. lipids from one membrane system to another. Newly forming. transport

21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003).

9 Sep 1998: The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998. Crystal structure of the amphiphysin-2 SH3 domainand its role in the prevention of dynamin ringformation. D.J.Owen, P.Wigge, Y.Vallis, J.D.A.Moore,P.R.Evans and H.T.McMahon1. MRC Laboratory of

31 Jul 2019: A common approach included single dropswith final volumes of 200 nL with a 1:1 ratio (100 nL of proteinand 100 nL of precipitant solution).

10 Nov 2000: 200,000 3 g for 40 min.

8 Nov 2004: ng TF ng PrP-TF. 5 10 200 Opn. PrP. Prl. ng TF 10 ng SS-TF. ... 200 ngDNA per well.

3 Feb 1997: 8. C, and 200. m. l fractions were collected. 13 ml Sucrose Gradients. ... d. ). Thispellet was washed twice with 200. m. l of the above nondetergent buffer toremove traces of detergent, and then resuspended.

9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl,

26 Feb 2019: reconstituted in buffer containing 40 mM NaCl, 2 mM MgCl2 (red) and doublet MukBEF (MukBEFD) reconstituted in buffer containing 200 mM NaCl (green).

20 Jul 2007: mix - add 200 μl water, mix vigorously - centrifuge 2 min 10.000x g - take top phase off ( 500 μl), protein forms precipitated layer - add 300 μl methanol - centrifuged 1 min

3 Dec 2004: AP2was dialyzed against 50 mM triethanolamine-KCl,pH 8.0, 200 mM NaCl, 0.2 mM EDTA, 0.1% b-mer-captoethanol, and 0.02% NaN3.

1 Dec 2010: Smc1DDSmc3AAA. ARS207 ARS231. 150 160 170 180 190 200. 10.0. 5.01.00.0. ... 5.0. 1.00.0. Smc1DD E1158QSmc3AAA. ARS207 ARS231. 150 160 170 180 190 200.

16 Jun 2006: 5) , andthe i r w i dth rema i ned fa i r l y constant (800 - 1 , 200 A).

14 Jun 2007: 0 50 100 150 200. 0.22. 0.27 27 nM. 61 nM. ... Superdex 200 10/300 column. 16 20128. 6 10 14 18Elution volume (ml).

8 Dec 2007: 150. 200. WT E542K E545K Q546K- - - - p85ni. p110 α. ... 0. 50. 100. 150. 200. 250. - - Phosphopeptide. C. B.

12 Aug 2006: agent (200 ml in 700 ml water) was added and Pi release monitored. ... tios of these proteins were mixed (in buffer A plus 200 mM NaCl;.

9 Dec 1999: sym. pto. mat. ic. Age (days)200 400 600 800. c. b(A. ... 80. 60. 40. 20. 00 100 200 300 400. (A117V) H(STE).

30 Sep 2016: Crystallization and data collection for XerDC-FtsKγ. Initial hits were identified using 200 nl protein drops, using commercial screens (Molecular Dimensions) mixed by Mosquito nano-litre robot (TTP Labtech).

19 Jan 2005: available: the IMPAX and ORYX systems from Douglas Instruments Ltd., UK, and theCyberlab 200, distributed by Gilson Inc., USA.

2 Jun 2007: a Superdex 200 column; 130 mM mFCHo2 (res-. idues 1–261) was loaded. ... H) Control Folch fraction 1 liposomes without addition of protein. The scale bars represent 200 nm.

15 Dec 2008: Membranes were stained using 10 µg/mL FM-464 for ten minutes. 200 µL of cells were taken directly from.

29 Aug 2021: 200 mM NaCl, 2 mM MgCl2,and 1 mM Tris(2-carboxyethyl)phosphine (TCEP). ... fast, direct-electron detector (Falcon 4,248 Hz), allowed us to acquire more than 200 micrographs per hour for 14 con-secutive days.

10 Oct 1997: Interestingly, although P2 (200 mM)efficiently blocks the Amph1– dynamin interaction, thebinding of Amph2 SH3 domain is much less wellinhibited (Figure 4B). ... GST-tagged SH3 domains were incubated as in A but in thepresence or absence of each of the

13 Dec 2017: secMAXI 24 200 1.8 2 min 25 secMAXI 48 200 3 4 min 20 sec.

26 Aug 2019: a b c. d e f. g h. i. 200 nm crossover distance. ... e (R. U). Time (s). WT. 0. 100. 200. 300. –1 10 14 24.