Search

Search Funnelback University

Search powered by Funnelback
1 - 50 of 2,010 search results for KaKaoTalk:vb20 200 where 0 match all words and 2,010 match some words.
  1. Results that match 1 of 2 words

  2.  The Rockefeller University Press, 0021-9525/97/02/567/15 $2.00The…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/8_Lingappa_JE_JCB_1997.pdf
    3 Feb 1997: 8. C, and 200. m. l fractions were collected. 13 ml Sucrose Gradients. ... d. ). Thispellet was washed twice with 200. m. l of the above nondetergent buffer toremove traces of detergent, and then resuspended.
  3. Molecular Biology of the CellVol. 8, 2003–2015, October 1997 ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/WiggeKohler_McMahon1997.pdf
    10 Oct 1997: Interestingly, although P2 (200 mM)efficiently blocks the Amph1– dynamin interaction, thebinding of Amph2 SH3 domain is much less wellinhibited (Figure 4B). ... GST-tagged SH3 domains were incubated as in A but in thepresence or absence of each of the
  4. Nature © Macmillan Publishers Ltd 1998 8 30. Fan, ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsZ.Nature.pdf
    9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl,
  5. Structural and Mechanistic Comparison of Prokaryotic and Eukaryotic…

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/9466937.pdf
    15 Jan 1998: 433 440 (Tb4) 1.15 (8)V 173 178 498 503 (Tb5) 3.36 (6)Vb 182 188 VI 193 200 518 524 (Tb6) 1.10 (5)VII 226 235 546
  6. Molecular Cell, Vol. 2, 85–91, July, 1998, Copyright 1998 ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/13_Hegde_RS_MolCell_1998.pdf
    16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine
  7. The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998 Crystal structure ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Owen_McMahon1998.pdf
    9 Sep 1998: The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998. Crystal structure of the amphiphysin-2 SH3 domainand its role in the prevention of dynamin ringformation. D.J.Owen, P.Wigge, Y.Vallis, J.D.A.Moore,P.R.Evans and H.T.McMahon1. MRC Laboratory of
  8. cm6307.qxd

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/TAXOL.C&B.pdf
    18 Feb 1999: 110 120 130 140 150 160 170 180 190 200. 210 220 230 240 250 260 270 280 290 300.
  9. Cambridge University Reporter No 2

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/8.pdf
    3 Mar 1999: continued >. Subject 200: MacroeconomicsCourse Co-ordinator: Mr K. J. Coutts. MR K.
  10. Cambridge University Reporter No 2

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/5.pdf
    3 Mar 1999: DR P. J. FORDIntroduction to Part I of the Tripos (One lecture,. 6 Oct.). Tu. 2 Lady Mitchell HallDR E. ESCHMML Learning Day. S. 2–4 (One lecture, 10 Oct.). Surnames A–M 2–3Surnames N–Z 3–4. C L A S S I C A L G R E E K A N D L AT I
  11. Cambridge University Reporter No 2

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/19.pdf
    3 Mar 1999: SPECIAL NO. 2] LECTURE-LIST–MICHAELMAS TERM 1998 169. NAT U R A L S C I E N C E S T R I P O S, PA RT I A. M I C H A E L M A S 1 9 9 8 L E N T 1 9 9 9 E A S T E R 1 9 9 9. L E A R N I N G DAY. Committee for the Natural Sciences Tripos Learning Day
  12. The EMBO Journal Vol.18 No.9 pp.2364–2371, 1999 Tubulin-like…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/EMBO%20paper%201999%20FtsZ.pdf
    20 Apr 1999: Twenty four micrographs out of 200 in the tilt range of 0–60 wereselected and scanned on a Zeiss SCAI scanner with a 28µm step size.Images were processed with the
  13. articles Nucleotide-dependent conformational changes in dynamin:…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Stowell_McMahon1999.pdf
    30 Apr 1999: 2,000. 500. a. Time (min). Time (min). 200. µM GTP. GT. ... ferase-tagged amphiphysin-2 SH3 domain on glutathione–agarose beads at 4 C. After extensive washing of the matrix in buffer A (200 mM NaCl, 20 mM HEPES, pH 7.3,
  14. Crystal Structure of the Two N-terminal Domains of g3p from…

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10329170.pdf
    6 May 1999: Thus anunfolding of the hinge sub-domain may expose theTolA-binding site on D1 and release the g3pdomains like beads on a string, allowing them tospan a large distance (> 200 AÊ )
  15. Cambridge University Reporter Special No 16

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/16/1.pdf
    8 May 1999: O R D E R S O F E X A M I N AT I O N S. Archaeology and Anthropology. 2Architecture. 3Anglo-Saxon, Norse, and Celtic. 4Chemical Engineering. 5Classics. 6Computer Science. 7Economics. 8Education. 9Engineering. 11Electrical and Information Sciences.
  16. Cambridge University Reporter, 26 May 1999

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/weekly/5775/1.pdf
    26 May 1999: 99(. est). 1999. –200. 0(es. t). Research Grants and Contracts. Other Income. ... est). 1999. –200. 0(es. t). Purc. hasi. ng P. ower. at 1.
  17. Cambridge University Reporter, 26 May 1999

    https://www.reporter.admin.cam.ac.uk/reporter/1998-99/weekly/5775/2.pdf
    26 May 1999: 50). 0 (3. ,650. )(3. ,200. )0. (3,2. 00). (3,2. 96). ... es0. 1,10. 0 1,. 100. 0 1,. 200. 1,20. 0 0.
  18. st7a11.qxd

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MukB%20Structure%201999.pdf
    10 Sep 1999: mukB V.cholmukB H.inflmukB Y.pestmukB E.coli. S6 H4 H5 H6. ... Protein was eluted with the same buffercontaining 400 mM imidazole. The protein was applied to a sephacrylS-200 column (Amersham-Pharmacia) equilibrated in 20 mM Tris,200 mM NaCl, 1 mM
  19. Cambridge University Reporter Special

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/8.pdf
    8 Oct 1999: Th. F. 4, Th. 9. Subject 200: MacroeconomicsCourse Co-ordinator: Mr S.
  20. Cambridge University Reporter Special

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/21.pdf
    8 Oct 1999: 200 LECTURE-LIST–MICHAELMAS TERM 1999 [SPECIAL NO. 2. DR R. A. FOLEY AND DR S.
  21. Cambridge University Reporter Special

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/5.pdf
    8 Oct 1999: DR D. W. HOLTON AND OTHERSIntroduction to Part I of the Tripos. Tu. 2–3 (One. lecture, 5 Oct.) Lady Mitchell HallMR G. BURNAGEIntroduction to Computer-Assisted Language. Learning. Tu. 3–4, 4–51 (One lecture, 5 Oct.) Lady Mitchell Hall. MR A.
  22. N402_18f 313..320

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10580505.pdf
    11 Nov 1999: Ras binding domain Nα1 Nα2 Nα3 Nα4 Rβ1 Rβ2 Rα1. 150 160 170 180 190 200 210 220 230 240 250. ... contain one protein molecule in the asymmetric unit.Diffraction data were collected at ESRF beamlines ID2 and ID14-4 at 100K after freezingcrystals in
  23. d402_16g 822..826

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/15_Hegde_RS_Nature_1999.pdf
    9 Dec 1999: sym. pto. mat. ic. Age (days)200 400 600 800. c. b(A. ... 80. 60. 40. 20. 00 100 200 300 400. (A117V) H(STE).
  24. Reporter Special No 10

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/10/1.pdf
    18 Jan 2000: COMPULSORY CORE COURSESSubject 200: Macroeconomics. p. 87 PROF. W. H. BUITERMacroeconomics.
  25. Reporter Special No 16

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/16/1.pdf
    25 Apr 2000: 200–650 (MLT1 Paper ML1)O11. Classical traditions in the sciences (NST2HP Paper 1) Wesley Church,.
  26. Cambridge University Reporter, 14 June 2000

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/weekly/5814/1.pdf
    14 Jun 2000: Sp. ecia. l ini. tiat. ives. 01,. 200. 1,20. 00. 5,35. ... 95,. 359. 02,. 000. 2,00. 00. 2,20. 02,. 200. 02,. 400.
  27. Reporter Special No 18

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/18/2.pdf
    31 Jul 2000: 0 200 400 600 800 1,000 1,200 1,400 1,600 1,800. 1989. ... TOTAL FOR ALL 200 122 80 60 157 87 437 269 126 95 90 58 208 224 424 377COLLEGES.
  28. Student Number 2000

    https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/21/1.pdf
    18 Aug 2000: 2,200 19.2 11,4731975–76 7,127 80.4 1,732 19.6 8,859 2,070 79.5 534 20.5 2,604 9,197 80.2 ... 64.7 3,353 35.3 9,503 2,050 72.2 789 27.8 2,839 8,200 66.4 4,142 33.6 12,3421985–86 6,232
  29. Biol. Chem., Vol. 381, pp. 993 – 999, September/October ...

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/BiolChem%20Helical%20Tubes.pdf
    13 Sep 2000: Figure 2D) as published earlier (Löwe and Amos, 1999).Tubes assembled in the presence of GMPCPP show re-peats of 200 Å, 100 Å, 67 Å, and 50 Å (Figure 2E, ... In the case of the GMPCPP-inducedtubes, groups producing the 200 Å longitudinal
  30. Cambridge University Reporter Special Number 1

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/01/8.pdf
    29 Sep 2000: 12, F. 2, 9. Subject 200: MacroeconomicsCourse Co-ordinator: Mr K. Coutts.
  31. Cambridge University Reporter Special Number 1

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/01/5.pdf
    29 Sep 2000: DR D. W. HOLTON AND OTHERSIntroduction to Part I of the Tripos. Tu. 2–3. (One lecture, 3 Oct.) Lady Mitchell HallMR G. BURNAGEIntroduction to Computer-Assisted Language Learning. Tu. 3–4, 4–51 (One lecture, 3 Oct.) Lady Mitchell HallMS N.
  32. Cambridge University Reporter Special Number 1

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/01/19.pdf
    29 Sep 2000: SPECIAL NO. 1] LECTURE-LIST–MICHAELMAS TERM 2000 169. DR S. H. P. MADDRELLThe Living Cell. (Four lectures). PROF. D. J. ELLARMacromolecules in the Cell. (Five lectures). DR J. DAVIESMembranes: Molecular Superstructure. (Five lectures). DR K. V.
  33. pq240013132p

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/16_Wilhelm_JE_PNAS_2000.pdf
    10 Nov 2000: 200,000 3 g for 40 min.
  34. x96411u107

    https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/11136978.pdf
    1 Dec 2000: The displacement experiment was carried out by mixing 1 mMcontaining 1mM EDTA and 1mM DTT before addition into the assays.PI3K and 2 mM mant-ATP with 50 or 200 mM ... Equilibriumassay with a final ATP concentration of 200 mM with 1.26 mM MgCl2,and
  35. Annual Reports Michaelmas Term 2000: Sports Syndicate Appendices

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/10/1.pdf
    19 Jan 2001: Bore £320.00Squash – Men’s £1,300.00Squash – Women’s Joint ApplicationSwimming and Waterpolo £6,200.00Table Tennis £320.00Trampoline £550.00 £1,000.00Volleyball £1,900.00 £957.50TOTAL
  36. Crystal Structure of the SMC Head Domain: An ABC ATPase with 900…

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/TmSMChd%20JMB%202001.pdf
    20 Feb 2001: The protein is highlysoluble and stable in 200 mM sodium chloride-containing buffer, and runs as a monomer underthese conditions on size-exclusion columns (datanot shown). ... 20 % (w/v) glycerol,200 mM NaCl, and 0.004 % (v/v) DMSO.
  37. PII: S0014-5793(01)02216-5

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MinD%20FEBS.pdf
    5 Mar 2001: The protein was loaded directly onto a Sephacryl S200column (Amersham-Pharmacia) equilibrated in 200 mM NaCl, 20mM Tris, 1 mM EDTA and 1 mM NaN3 pH 7.0.
  38. M410_8e 231..235

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Dynamin.pdf
    6 Mar 2001: For the continuousenzyme-coupled assay, purine nucleotide phosphorylase (20 U ml-1) and 2-amino-6-mercapto-7-methylpurine ribonucleoside (MESG) (200 mM) were also present in thereaction mix from the
  39. cde235 2454..2461

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MinC%20EMBO%202001.pdf
    4 May 2001: 200 column buffer. ... solution, andadditionally 200 mM NaI in the drop.
  40. OrdersText01.qk

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/15/1.pdf
    24 May 2001: Continuity and change in Latin literature, from 200–650 (MLT1 Paper. ML1) Sidgwick Avenue Lecture-roomsWednesday 30 May 9–12 A2.
  41. rep5851

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/weekly/5851/pages871-880.pdf
    19 Jun 2001: Purchasing power of University expenditure 1992Ð2002. 0.0. 50.0. 100.0. 150.0. 200.0. ... com. e8,. 289. 15,2. 0023. ,489. 8,81. 115. ,200. 24,0. 118,.
  42. Easter2001

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/17/2.pdf
    4 Jul 2001: 0 200 400 600 800 1,000 1,200 1,400 1,600 1,800 2,000. ... 38 27 122 86Wolfson College 70 47 48 26 111 62 229 135 65 43 43 22 92 48 200 113.
  43. Student Number 2001

    https://www.reporter.admin.cam.ac.uk/reporter/2000-01/special/19/studentnumber2001.pdf
    20 Aug 2001: 2,200 19.2 11,4731975–76 7,127 80.4 1,732 19.6 8,859 2,070 79.5 534 20.5 2,604 9,197 80.2 ... 64.7 3,353 35.3 9,503 2,050 72.2 789 27.8 2,839 8,200 66.4 4,142 33.6 12,3421985–86 6,232
  44. S413_6a 39..44

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MreB%20Nature.pdf
    30 Aug 2001: S8 H4 S9 S10 S11 H5. 200 210 220 230 240 250ER.GYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP.DGQVITIG.NKTYNLMI.GDRTAEAIKMEIGSAE.APEESD.NMEIRGRDLLTGLPKTIEITGKETYRVAI.GERTAERVKIEIGNVF.PSKEND.ELETTVSGIDLSTGLPRKLTLKGG. ... 200 210 220 230 240. H6 H7 S12 S13
  45. LectList2001

    https://www.reporter.admin.cam.ac.uk/reporter/2001-02/special/01/p88-96.pdf
    28 Sep 2001: Subject 200: MacroeconomicsCourse Co-ordinator: Mr K. Coutts. MR K. COUTTS, DR G.
  46. LectList2001

    https://www.reporter.admin.cam.ac.uk/reporter/2001-02/special/01/p160-171.pdf
    28 Sep 2001: 200). T WO PA P E R S U B J E C T SCellular and Molecular Pharmacology.
  47. LectList2001

    https://www.reporter.admin.cam.ac.uk/reporter/2001-02/special/01/p172-207.pdf
    28 Sep 2001: DR S. H. P. MADDRELLThe Living Cell. (Four lectures). PROF. D. J. ELLARMacromolecules in the Cell. (Five lectures). DR J. DAVIESMembranes: Molecular Superstructure. (Five lectures). DR K. JOHNSTONE AND DR K. V. BRINDLEEnergy and Biosynthesis. (Ten
  48. Refined Structure of (alpha)(beta)-Tubulin at 3.5 A Resolution

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/jmb%20tubulin%20refinement.pdf
    3 Nov 2001: In fungi b-tubulin alsohas a phenylalanine at position 202, and accord-ingly residue 167 is an alanine while there is noconsensus for position 200.
  49. White2001.PDF

    https://www.trin.cam.ac.uk/download/college-accounts-2001/?wpdmdl=1284&refresh=6649d7bf093b61716115391
    15 Feb 2002: 44,729Rent of rooms occupied free by Scholars: Whewell's Courts. 2,200 Other. ... 500. and Exhibitioners. 56,146 Lecturers. 26 Other income: Prizes. 200 Repayment of loans.
  50. White2001.PDF

    https://www.trin.cam.ac.uk/download/college-accounts-2001/?wpdmdl=1284&refresh=6649d734ad71d1716115252
    15 Feb 2002: 44,729Rent of rooms occupied free by Scholars: Whewell's Courts. 2,200 Other. ... 500. and Exhibitioners. 56,146 Lecturers. 26 Other income: Prizes. 200 Repayment of loans.
  51. White2001.PDF

    https://www.trin.cam.ac.uk/download/college-accounts-2001/?wpdmdl=1284&refresh=6649d66ac345e1716115050
    15 Feb 2002: 44,729Rent of rooms occupied free by Scholars: Whewell's Courts. 2,200 Other. ... 500. and Exhibitioners. 56,146 Lecturers. 26 Other income: Prizes. 200 Repayment of loans.

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.