Search
Search Funnelback University
- Refined by:
- Format: pdf
1 -
20 of
2,011
search results for KaKaoTalk:vb20 200
where 0
match all words and 2,011
match some words.
Results that match 1 of 2 words
-
The Rockefeller University Press, 0021-9525/97/02/567/15 $2.00The…
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/8_Lingappa_JE_JCB_1997.pdf3 Feb 1997: 8. C, and 200. m. l fractions were collected. 13 ml Sucrose Gradients. ... d. ). Thispellet was washed twice with 200. m. l of the above nondetergent buffer toremove traces of detergent, and then resuspended. -
Molecular Biology of the CellVol. 8, 2003–2015, October 1997 ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/WiggeKohler_McMahon1997.pdf10 Oct 1997: Interestingly, although P2 (200 mM)efficiently blocks the Amph1– dynamin interaction, thebinding of Amph2 SH3 domain is much less wellinhibited (Figure 4B). ... GST-tagged SH3 domains were incubated as in A but in thepresence or absence of each of the -
Nature © Macmillan Publishers Ltd 1998 8 30. Fan, ...
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/FtsZ.Nature.pdf9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl, -
Structural and Mechanistic Comparison of Prokaryotic and Eukaryotic…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/9466937.pdf15 Jan 1998: 433 440 (Tb4) 1.15 (8)V 173 178 498 503 (Tb5) 3.36 (6)Vb 182 188 VI 193 200 518 524 (Tb6) 1.10 (5)VII 226 235 546 -
Molecular Cell, Vol. 2, 85–91, July, 1998, Copyright 1998 ...
https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/13_Hegde_RS_MolCell_1998.pdf16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine -
The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998 Crystal structure ...
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Owen_McMahon1998.pdf9 Sep 1998: The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998. Crystal structure of the amphiphysin-2 SH3 domainand its role in the prevention of dynamin ringformation. D.J.Owen, P.Wigge, Y.Vallis, J.D.A.Moore,P.R.Evans and H.T.McMahon1. MRC Laboratory of -
cm6307.qxd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/TAXOL.C&B.pdf18 Feb 1999: 110 120 130 140 150 160 170 180 190 200. 210 220 230 240 250 260 270 280 290 300. -
Cambridge University Reporter No 2
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/8.pdf3 Mar 1999: continued >. Subject 200: MacroeconomicsCourse Co-ordinator: Mr K. J. Coutts. MR K. -
Cambridge University Reporter No 2
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/5.pdf3 Mar 1999: DR P. J. FORDIntroduction to Part I of the Tripos (One lecture,. 6 Oct.). Tu. 2 Lady Mitchell HallDR E. ESCHMML Learning Day. S. 2–4 (One lecture, 10 Oct.). Surnames A–M 2–3Surnames N–Z 3–4. C L A S S I C A L G R E E K A N D L AT I -
Cambridge University Reporter No 2
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/02/19.pdf3 Mar 1999: SPECIAL NO. 2] LECTURE-LIST–MICHAELMAS TERM 1998 169. NAT U R A L S C I E N C E S T R I P O S, PA RT I A. M I C H A E L M A S 1 9 9 8 L E N T 1 9 9 9 E A S T E R 1 9 9 9. L E A R N I N G DAY. Committee for the Natural Sciences Tripos Learning Day -
The EMBO Journal Vol.18 No.9 pp.2364–2371, 1999 Tubulin-like…
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/EMBO%20paper%201999%20FtsZ.pdf20 Apr 1999: Twenty four micrographs out of 200 in the tilt range of 0–60 wereselected and scanned on a Zeiss SCAI scanner with a 28µm step size.Images were processed with the -
articles Nucleotide-dependent conformational changes in dynamin:…
https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Stowell_McMahon1999.pdf30 Apr 1999: 2,000. 500. a. Time (min). Time (min). 200. µM GTP. GT. ... ferase-tagged amphiphysin-2 SH3 domain on glutathione–agarose beads at 4 C. After extensive washing of the matrix in buffer A (200 mM NaCl, 20 mM HEPES, pH 7.3, -
Crystal Structure of the Two N-terminal Domains of g3p from…
https://www2.mrc-lmb.cam.ac.uk/groups/rlw/download/publications/10329170.pdf6 May 1999: Thus anunfolding of the hinge sub-domain may expose theTolA-binding site on D1 and release the g3pdomains like beads on a string, allowing them tospan a large distance (> 200 AÊ ) -
Cambridge University Reporter Special No 16
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/special/16/1.pdf8 May 1999: O R D E R S O F E X A M I N AT I O N S. Archaeology and Anthropology. 2Architecture. 3Anglo-Saxon, Norse, and Celtic. 4Chemical Engineering. 5Classics. 6Computer Science. 7Economics. 8Education. 9Engineering. 11Electrical and Information Sciences. -
Cambridge University Reporter, 26 May 1999
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/weekly/5775/1.pdf26 May 1999: 99(. est). 1999. –200. 0(es. t). Research Grants and Contracts. Other Income. ... est). 1999. –200. 0(es. t). Purc. hasi. ng P. ower. at 1. -
Cambridge University Reporter, 26 May 1999
https://www.reporter.admin.cam.ac.uk/reporter/1998-99/weekly/5775/2.pdf26 May 1999: 50). 0 (3. ,650. )(3. ,200. )0. (3,2. 00). (3,2. 96). ... es0. 1,10. 0 1,. 100. 0 1,. 200. 1,20. 0 0. -
st7a11.qxd
https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/MukB%20Structure%201999.pdf10 Sep 1999: mukB V.cholmukB H.inflmukB Y.pestmukB E.coli. S6 H4 H5 H6. ... Protein was eluted with the same buffercontaining 400 mM imidazole. The protein was applied to a sephacrylS-200 column (Amersham-Pharmacia) equilibrated in 20 mM Tris,200 mM NaCl, 1 mM -
Cambridge University Reporter Special
https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/8.pdf8 Oct 1999: Th. F. 4, Th. 9. Subject 200: MacroeconomicsCourse Co-ordinator: Mr S. -
Cambridge University Reporter Special
https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/21.pdf8 Oct 1999: 200 LECTURE-LIST–MICHAELMAS TERM 1999 [SPECIAL NO. 2. DR R. A. FOLEY AND DR S. -
Cambridge University Reporter Special
https://www.reporter.admin.cam.ac.uk/reporter/1999-2000/special/02/5.pdf8 Oct 1999: DR D. W. HOLTON AND OTHERSIntroduction to Part I of the Tripos. Tu. 2–3 (One. lecture, 5 Oct.) Lady Mitchell HallMR G. BURNAGEIntroduction to Computer-Assisted Language. Learning. Tu. 3–4, 4–51 (One lecture, 5 Oct.) Lady Mitchell Hall. MR A.
Refine your results
Date
- 229 2016
- 175 Past year
- 144 2017
- 120 2019
- 118 2022
- 115 2023
- 113 Past 6 months
- 111 2014
- 108 2020
- 106 2018
- 102 2015
- 102 2021
- 95 2024
- 80 2008
- 75 2013
- 66 Past 3 months
- 60 2011
- 55 2007
- 54 2010
- 51 2004
- 50 2012
- 49 2009
- 43 2006
- 39 2005
- 34 2002
- 28 Past month
- 24 2003
- 16 1999
- 14 2001
- 11 2000
- 9 Past fortnight
- 6 Past week
- 4 1998
- 2 1997
- 1 Yesterday
Search history
Recently clicked results
Recently clicked results
Your click history is empty.
Recent searches
Recent searches
Your search history is empty.