Search

3 Feb 1997: 8. C, and 200. m. l fractions were collected. 13 ml Sucrose Gradients. ... d. ). Thispellet was washed twice with 200. m. l of the above nondetergent buffer toremove traces of detergent, and then resuspended.

10 Oct 1997: Interestingly, although P2 (200 mM)efficiently blocks the Amph1– dynamin interaction, thebinding of Amph2 SH3 domain is much less wellinhibited (Figure 4B). ... GST-tagged SH3 domains were incubated as in A but in thepresence or absence of each of the

9 Jan 1998: H3 S5 H4 S6 HL2. TGTGSAPVVAEISKKIGALTVAVVTLPFVMEGKVRMKNAMEGLERLKQHTDTLVVIPNEKLFEIVPN140 150 160 170 180 190 200. ... The frozen pellet was powdered under liquid nitrogen and poureddirectly into 200 ml of boiling buffer A (50 mM Tris-HCl, 300 mM NaCl,

15 Jan 1998: 433 440 (Tb4) 1.15 (8)V 173 178 498 503 (Tb5) 3.36 (6)Vb 182 188 VI 193 200 518 524 (Tb6) 1.10 (5)VII 226 235 546

16 Jul 1998: 200 ml was applied by gravity to amoter in the SP64 plasmid, have been described previously (Simon100 ml column of ConA, previously equilibrated in extraction bufferet al., 1987; Hegde et al., ... the first 200 ml of the eluate were savedhistidine

9 Sep 1998: The EMBO Journal Vol.17 No.18 pp.5273–5285, 1998. Crystal structure of the amphiphysin-2 SH3 domainand its role in the prevention of dynamin ringformation. D.J.Owen, P.Wigge, Y.Vallis, J.D.A.Moore,P.R.Evans and H.T.McMahon1. MRC Laboratory of

18 Feb 1999: 110 120 130 140 150 160 170 180 190 200. 210 220 230 240 250 260 270 280 290 300.

20 Apr 1999: Twenty four micrographs out of 200 in the tilt range of 0–60 wereselected and scanned on a Zeiss SCAI scanner with a 28µm step size.Images were processed with the

30 Apr 1999: 2,000. 500. a. Time (min). Time (min). 200. µM GTP. GT. ... ferase-tagged amphiphysin-2 SH3 domain on glutathione–agarose beads at 4 C. After extensive washing of the matrix in buffer A (200 mM NaCl, 20 mM HEPES, pH 7.3,

6 May 1999: Thus anunfolding of the hinge sub-domain may expose theTolA-binding site on D1 and release the g3pdomains like beads on a string, allowing them tospan a large distance (> 200 AÊ )