Search

Search Funnelback University

Search powered by Funnelback
1 - 11 of 11 search results for KaKaoTalk:vb20 200 |u:www2.mrc-lmb.cam.ac.uk where 0 match all words and 11 match some words.
  1. Results that match 1 of 2 words

  2. YopJ activation by IP6

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/Black_Plague/YopJ_IP6.html
    26 Sep 2011: Researching the reason immune responses are sprroessed during Yersinia infections.
  3. Nobel Laureate, Sir Aaron Klug, donates his archives to Churchill…

    https://www2.mrc-lmb.cam.ac.uk/nobel-laureate-sir-aaron-klug-donates-his-archives-to-churchill-archives-centre/
    Thumbnail for Nobel Laureate, Sir Aaron Klug, donates his archives to Churchill Archives Centre. - MRC Laboratory of Molecular Biology 26 Apr 2011: In total, about 200 boxes have been placed in Churchill Archives Centre.
  4. molcel3956mmc1

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Salje2011Supp.pdf
    20 Jul 2011: mM Tris pH 7.5, 1 mM EDTA, 1 mM sodium azide and 200 mM NaCl). ... with buffer A being (20 mM Tris pH 8.5, 500 mM NaCl, 1 mM EDTA, 1 mM TCEP) and buffer B (20 mM Tris pH 8.0, 200 mM NaCl,
  5. 373_431_BIOsp_0411

    https://www2.mrc-lmb.cam.ac.uk/groups/JYL/PDF/Biospektrum2011%20Gasper.pdf
    1 Jul 2011: Von großem Vorteil ist dabei diedynamische Instabilität der ParM-Filamente:Die sich schnell wiederholende Abfolge vonFilamentbildung und -zerfall (ungefähr 200-mal schneller als bei Aktin) ermöglicht esParM, nach den Plasmiden zu
  6. A Conserved Archaeal Pathway for TailAnchored Membrane Protein…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/70_Sherrill_J_Traffic_2011.pdf
    11 Nov 2011: coli ArsA (B). NLQVSRIDPHEETERYRQHVLETKGKELD.EAGKRLLEEDLR.SPCTEEIAVFQAFSRVIR.EAGKRFVVMDTAPTGHTLLLL. Switch II. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -. 160. 170. 180. 190. 200. 210. 220. 230. 240. 250. H.sapiens ... After clearing
  7. Cellular/Molecular Endophilin Drives the Fast Mode of Vesicle…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/Llobet%20J%20Neurosci2011.pdf
    23 Sep 2011: 08907 L’Hospitalet de Llobregat, Spain.J. L. Gallop’s present address: Harvard Medical School, Department of Systems Biology, 200 Longwood Avenue,. ... For tubulationassays, typically 1 mg/ml liposomes (200 nm) were incubated for 10 minwith 10, 20,
  8. JCB: Article The Rockefeller University Press $30.00J. Cell Biol. ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/J%20Cell%20Biol%202010%20Howes.pdf
    24 Aug 2011: Bars, 200 nm. on August 24, 2011. jcb.rupress.orgD. ownloaded from. Published August 16, 2010. ... Bar, 200 nm. (E) NIH3T3 cells transfected with Cdc42-WT or -DN were incubated with CTxB before fractionation.
  9. Protein targeting and degradation are coupled for elimination of…

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/73_Hessa_T_Nature_2011.pdf
    14 Jul 2011: at 4 uC in a TLS-55 rotor(Beckman), after which 200 ml fractions were removed from the top. ... For shRNA experiments, each well received amixture of 550 ng shRNA plasmid, 200 ng PrP expression plasmid and 50 ng CFPexpression plasmid.
  10. Molecular Biology of the CellVol. 21, 3054 –3069, September ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/RVS161_MBC2010.pdf
    21 Feb 2011: Liposomes formtubules 18 –20 nm in diameter (arrow). Scale bar, 200 nm. ... ment of 200 nm upon arrival of the actin patch protein,Abp1 (Kaksonen et al., 2003).
  11. Molecular mechanism and physiological functions of clathrin-mediated…

    https://www2.mrc-lmb.cam.ac.uk/groups/hmm/publica/Papers/McMahon%20NRMB%202011.pdf
    19 Jul 2011: 3a). The size of clathri n-coated vesicles depends on the size of its cargo76, with an observed upper limit of about 200 nm external diameter, as in the case of
  12. Volume 22 May 15, 2011 1625 Cytosolic aggregates perturb ...

    https://www2.mrc-lmb.cam.ac.uk/groups/hegde/download/69_Chakrabarti_O_MBC_2011.pdf
    11 Nov 2011: Volume 22 May 15, 2011 1625. Cytosolic aggregates perturb the degradation of nontranslocated secretory and membrane proteinsOishee Chakrabarti, Neena S. Rane, and Ramanujan S. HegdeCell Biology and Metabolism Program, Eunice Kennedy Shriver National

Refine your results

Format

Search history

Recently clicked results

Recently clicked results

Your click history is empty.

Recent searches

Recent searches

Your search history is empty.